View original HTML file with complete header information
oṃ namaḥ sarvabuddhabodhisattvebhyaḥ // / ñ1.1 evaṃ mayā śru[tam eka{smin}?] samaye bhagavāṃ cchrāvastyāṃ viharati
Srimahadevivyakaranam (bsu007_u.htm.txt) 7925997 (5.960):
Āryaśrīmahādevīvyākaraṇam [= Dvādaśadaṇḍakanāmāṣṭaśatavimalīkaraṇā] / om namaḥ sarvabuddhabodhisattvebhyaḥ //
Gunakarandavyuhasutra (bsu062_u.htm.txt) 24367156 (0.034):
om namaḥ śrīratnatrayāyaḥ namaḥ sarvabuddhabodhisattvebhyaḥ //
Devatasutra (GBM 1542.5 - 1545.3) (dvtasutu.htm.txt) 17498569 (0.036):
evaṃ mayā śrutam ekasmiṃ samaye bhagavāṃ cchrāvastyāṃ viharati sma
DASABALASUTRA 1-4 (dbsu1-4u.htm.txt) 24820751 (0.044):
DbSū(1) 0. evaṃ mayā śrutaṃ / ekasmiṃ samaye bhagavāṃ śrāvastyāṃ viharati / sma jetavane anāthapiṇḍadasyārāme /
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19040124 (0.044):
evaṃ mayā śrutam ekasmiṃ samaye bhagavāṃ śrāvastyāṃ viharati sma, jetavane
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142672 (0.045):
nāmastryadhvānugatapratiṣṭhitebhya sarvabuddhabodhisattvebhyo namaḥ
Bower Manuscript. (bowermsu.htm.txt) 18508581 (0.047):
r1 {X} evaṃ mayā śrutam ekasmin samaye bhagavāṃ cchrāvastyāṃ viharati
Sagaranagarajapariprccha (bsu038_u.htm.txt) 8513170 (0.048):
Punaruddhṛtam namaḥ sarvabuddhabodhisattvebhyaḥ /
Manjusrimulakalpa (bsu041_u.htm.txt) 11455741 (0.052):
namaḥ sarvabuddhabodhisattvebhyo 'pratihataśāsanebhyaḥ / om hana hana
Santideva: Siksasamuccaya (sanssr_pu.htm.txt) 26926117 (0.052):
namaḥ sarvabuddhabodhisatvebhyaḥ || / yasyāśraveṇa narakādi mahāprapātadāhādiduṣkham anubhūtam abhūd bhavadbhiḥ
Vimsatikakarika (bsa023_u.htm.txt) 16544613 (0.053):
// namaḥ sarvabuddhabodhisattvebhyaḥ // / Viṃśatikākārikā (Vk)
Ekadasamukham (bsu015_u.htm.txt) 21404760 (0.054):
oṃ namaḥ sarvabuddhabodhisattvebhyaḥ // / evaṃ mayā śrutamekasamaye bhagavān śrāvastyāṃ viharati sma karīramaṇḍale
Gandavyuhasutra (bsu016_u.htm.txt) 28587882 (0.054):
// om namaḥ sarvabuddhabodhisattvebhyaḥ // / evaṃ mayā śrutam / ekasmin samaye bhagavān śrāvastyāṃ viharati sma
Sarvajnatakaradharani (sjdh_u.htm.txt) 10693785 (0.054):
oṃ namaḥ sarvabuddhabodhisattvebhyaḥ / / evaṃ mayā śrutam / ekasmiṃ samaye bhagavān rājagṛhe viharati sma,
Mahavastu-Avadana (mhvastuu.htm.txt) 18614907 (0.057):
evaṃ mayā śrutamekasmiṃ samaye bhagavāṃ rājagṛhe viharati sma gṛdhrakūṭe
Satasahasrika Prajnaparamita II-1 (sspp2_1u.htm.txt) 24883216 (0.058):
(ŚsP_II 1_1) / oṃ namaḥ sarvabuddhabodhisattvebhyaḥ.
Kamalasila: Bhavanakrama (bsa047_u.htm.txt) 9565492 (0.060):
kariṣyāmi yathā sarvajñatvaṃ prāpya eteṣāṃ dharmatāmavabodhayeyamiti / / tataḥ sarvabuddhabodhisattvebhyaḥ pūjāstotropahāraṃ kṛtvā
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1858762 (0.060):
VAJRADHATU MAHA MANDALA VIDHI VISTARA MANDALA I.1 / [evaṃ mayā śru]tamekasmin samaye bhagavān
Ahoratravratakatha (ahovk1_u.htm.txt) 15158143 (0.061):
evaṃ mayā śrutam ekasmin samaye buddho bhagavāñ chrāvastyāṃ viharati sma
Grahamatrkanamadharani (grahmdhu.htm.txt) 26664770 (0.064):
oṃ namaḥ sarvatathāgatebhyaḥ sarvāśāparipūrakebhyaḥ sarvathā bhaktine
oṃ namaḥ sarvabuddhabodhisattvebhyaḥ // / ñ1.1 evaṃ mayā śru[tam eka{smin}?] samaye bhagavāṃ cchrāvastyāṃ viharati
Srimahadevivyakaranam (bsu007_u.htm.txt) 7925997 (5.960):
Āryaśrīmahādevīvyākaraṇam [= Dvādaśadaṇḍakanāmāṣṭaśatavimalīkaraṇā] / om namaḥ sarvabuddhabodhisattvebhyaḥ //
Gunakarandavyuhasutra (bsu062_u.htm.txt) 24367156 (0.034):
om namaḥ śrīratnatrayāyaḥ namaḥ sarvabuddhabodhisattvebhyaḥ //
Devatasutra (GBM 1542.5 - 1545.3) (dvtasutu.htm.txt) 17498569 (0.036):
evaṃ mayā śrutam ekasmiṃ samaye bhagavāṃ cchrāvastyāṃ viharati sma
DASABALASUTRA 1-4 (dbsu1-4u.htm.txt) 24820751 (0.044):
DbSū(1) 0. evaṃ mayā śrutaṃ / ekasmiṃ samaye bhagavāṃ śrāvastyāṃ viharati / sma jetavane anāthapiṇḍadasyārāme /
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19040124 (0.044):
evaṃ mayā śrutam ekasmiṃ samaye bhagavāṃ śrāvastyāṃ viharati sma, jetavane
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142672 (0.045):
nāmastryadhvānugatapratiṣṭhitebhya sarvabuddhabodhisattvebhyo namaḥ
Bower Manuscript. (bowermsu.htm.txt) 18508581 (0.047):
r1 {X} evaṃ mayā śrutam ekasmin samaye bhagavāṃ cchrāvastyāṃ viharati
Sagaranagarajapariprccha (bsu038_u.htm.txt) 8513170 (0.048):
Punaruddhṛtam namaḥ sarvabuddhabodhisattvebhyaḥ /
Manjusrimulakalpa (bsu041_u.htm.txt) 11455741 (0.052):
namaḥ sarvabuddhabodhisattvebhyo 'pratihataśāsanebhyaḥ / om hana hana
Santideva: Siksasamuccaya (sanssr_pu.htm.txt) 26926117 (0.052):
namaḥ sarvabuddhabodhisatvebhyaḥ || / yasyāśraveṇa narakādi mahāprapātadāhādiduṣkham anubhūtam abhūd bhavadbhiḥ
Vimsatikakarika (bsa023_u.htm.txt) 16544613 (0.053):
// namaḥ sarvabuddhabodhisattvebhyaḥ // / Viṃśatikākārikā (Vk)
Ekadasamukham (bsu015_u.htm.txt) 21404760 (0.054):
oṃ namaḥ sarvabuddhabodhisattvebhyaḥ // / evaṃ mayā śrutamekasamaye bhagavān śrāvastyāṃ viharati sma karīramaṇḍale
Gandavyuhasutra (bsu016_u.htm.txt) 28587882 (0.054):
// om namaḥ sarvabuddhabodhisattvebhyaḥ // / evaṃ mayā śrutam / ekasmin samaye bhagavān śrāvastyāṃ viharati sma
Sarvajnatakaradharani (sjdh_u.htm.txt) 10693785 (0.054):
oṃ namaḥ sarvabuddhabodhisattvebhyaḥ / / evaṃ mayā śrutam / ekasmiṃ samaye bhagavān rājagṛhe viharati sma,
Mahavastu-Avadana (mhvastuu.htm.txt) 18614907 (0.057):
evaṃ mayā śrutamekasmiṃ samaye bhagavāṃ rājagṛhe viharati sma gṛdhrakūṭe
Satasahasrika Prajnaparamita II-1 (sspp2_1u.htm.txt) 24883216 (0.058):
(ŚsP_II 1_1) / oṃ namaḥ sarvabuddhabodhisattvebhyaḥ.
Kamalasila: Bhavanakrama (bsa047_u.htm.txt) 9565492 (0.060):
kariṣyāmi yathā sarvajñatvaṃ prāpya eteṣāṃ dharmatāmavabodhayeyamiti / / tataḥ sarvabuddhabodhisattvebhyaḥ pūjāstotropahāraṃ kṛtvā
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1858762 (0.060):
VAJRADHATU MAHA MANDALA VIDHI VISTARA MANDALA I.1 / [evaṃ mayā śru]tamekasmin samaye bhagavān
Ahoratravratakatha (ahovk1_u.htm.txt) 15158143 (0.061):
evaṃ mayā śrutam ekasmin samaye buddho bhagavāñ chrāvastyāṃ viharati sma
Grahamatrkanamadharani (grahmdhu.htm.txt) 26664770 (0.064):
oṃ namaḥ sarvatathāgatebhyaḥ sarvāśāparipūrakebhyaḥ sarvathā bhaktine
sma, karī[ṭe ma]ṇḍalavāṭe\var{karī[ṭema]ṇḍalavāṭe\lem \cod; karī[ma]ṇḍale
ca \Dutt} / / ñ1.2 atha khalv āryāvalokiteśvaro bodhisa[ttvo] mahāsattvo
Karandavyuha (bsu019_u.htm.txt) 7104881 (0.016):
sukuṇḍalo nāma devaputro daridro duścittaśceti / atha āryāvalokiteśvaraḥ
Ekadasamukham (bsu015_u.htm.txt) 21405225 (0.018):
udgṛhītaṃ camayā hṛdayamanumoditam / bhāṣadhvaṃ kulaputra / tataḥ / khalvāryāvalokiteśvaro bodhisattva utthāyasanādekāṃsamuttarāsaṅga kṛtvā
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23141892 (0.020):
devaputrān adhikṛtya dharma deśayati sma / / atha khalu āryāvalokiteśvaro bodhisattvo mahāsattva utthāyāsanādekāṃ
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142633 (0.020):
pitṛkāryakariṣyanti / atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo
Amoghapasahrdayasutra (amoghapu.htm.txt) 16994355 (0.020):
maheśvarabrahmakāyikadevaputrān adhikṛtya dharmaṃ deśayati sma / / atha khalu āryāvalokiteśvaro bodhisattvo mahāsattva utthāyāsanād ekāṃsam
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995107 (0.020):
kariṣyati / / atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo 'nimiṣanayano bhūtvā
Ekadasamukham (bsu015_u.htm.txt) 21404779 (0.020):
ca / atha khalvāryāvalokiteśvaro bodhisattvo mahāsattvo
Prajnakaramati: Bodhicaryavatarapanjika (bsa054_u.htm.txt) 19460835 (0.020):
buddhadharmāḥ pravartante / tathā coktamāryadharmasaṃgītau / atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo bhagavantametadavocat
Srimahadevivyakaranam (bsu007_u.htm.txt) 7926081 (0.020):
atha khalvāryāvalokiteśvaro bodhisattvo mahāsattvo yena
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444411 (0.020):
atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo bhagavantametadavocat
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995080 (0.029):
atha khalu bhagavān āryāvalokiteśvaro bodhisattvaṃ mahāsattvam etad
Gunakarandavyuhasutra (bsu062_u.htm.txt) 24408426 (0.034):
yo 'sau traidhātukādhiśa āryāvalokiteśvaraḥ /
Gunakarandavyuhasutra (bsu062_u.htm.txt) 24370477 (0.034):
yaḥ śrīmānmahābhijña āryāvalokiteśvaraḥ / / bodhisattvo mahāsattvaḥ sarvalokādhipeśvaraḥ //
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1888295 (0.035):
atha bhagavānāryāvalokiteśvaro bodhisatva idaṃ
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19035062 (0.035):
athāryāvalokiteśvaro bodhisattvo mahāsattvaḥ punarbhagavantametadavocat
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19035906 (0.035):
athāryāvalokiteśvaro bodhisattvo mahāsattvaḥ punarbhagavantametadavocat /
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1890283 (0.036):
atha vajraviśvo bodhisatva imāṃ svavidyottamāmabhāṣat oṃ viśvakarmi hūṃ // / athāryāvalokiteśvaro bodhisatvo mahāsatva idaṃ svakarmamaṇḍalamabhāṣat /
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1891225 (0.036):
III.6 Ekamudra mandala / athāryāvalokiteśvaro mahābodhisatva idaṃ sarvajagadvinayaṃnāma
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1891255 (0.036):
athāryāvalokiteśvaro mahābodhisatva idaṃ sarvajagadvinayaṃ nāma
Karandavyuha (bsu019_u.htm.txt) 7099457 (0.037):
athāryāvalokiteśvaro bodhisattvo mahāsattvastaṃ ca sattvanikāyaṃ dṛṣṭvā
'nekavidyādharakoṭīniyutaśatasaha[sreṇa] parivṛto yena bhagavāṃs
Ekadasamukham (bsu015_u.htm.txt) 21404786 (0.0):
ca / atha khalvāryāvalokiteśvaro bodhisattvo mahāsattvo / 'nekavidyādharakoṭīniyutaśatasahastrastreṇa parivṛto yena
Bhiksunivinaya (bhivin_u.htm.txt) 27845709 (0.029):
mayā teṣāṃ vairaṃ pratikartavyaṃ yadi bhagavāṃs teṣāṃ nānukampati | atha / bhagavān anukampati | nāhaṃ śakṣyāmi kiñcit pratikartuṃ | āmātyā āhaṃsuḥ |
Divyavadana (divyav_u.htm.txt) 21533903 (0.030):
041.001. div4 brāhmaṇadārikāvadānam/ / 041.002. bhagavān nyagrodhikāmanuprāptaḥ/ / 041.002. atha bhagavān pūrvāhṇe nivāsya pātracīvaramādāya nyagrodhikāṃ
Divyavadana (divyav_u.htm.txt) 21559660 (0.030):
puruṣadamyasārithaḥ śāstā devamanuṣyāṇāṃ buddho bhagavāniti/ / 122.009. atha bhagavān sāyāhṇe pratisamlayanādvyutthāya
Jnanalokalamkara [Sarvabuddhaviṣayāvatārajñānālokālaṃkāra nāma (jnalokau.htm.txt) 25714879 (0.035):
anyonyalokadhātuṣu tathāgatakoṭīniyutaśatasahasrasaṃpreṣitaiḥ, sarvair
Sardulakarnavadana (divav33u.htm.txt) 6648054 (0.035):
u14.8/.atha khalu bhoḥ puṣkarasārin luṅgādhyāyaṃ pravakṣyāmi/ tac / chrūyatāṃ/ atha kiṃ/kathayatu bhagavān triśaṅkuḥ//
Sardulakarnavadana (divav33u.htm.txt) 6646499 (0.035):
vyākhāsyāmi/ tac chrūyatāṃ/ atha kiṃ / kathāyatu bhagavān triśaṅkuḥ/
Manjusrimulakalpa (bsu041_u.htm.txt) 11350906 (0.040):
brahmalokamatikrāmati / anekavidyādharakoṭīnayutaśatasahasraparivāritaḥ
Manjusrimulakalpa (bsu041_u.htm.txt) 11351146 (0.040):
vidyudyotitamūrttiḥ sarvavidyādharaprabhuḥ dīrghajīvī mahākalpasthaḥ aneka / vidyādharakoṭīnayutaśatasahasraparivāraḥ divyamahāmaṇiratnacārī yena vā
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6889045 (0.040):
bodhisattvakoṭīniyuta / 00513 śatasahasraiḥ sārdham/
Mahapratisaramahavidyarajni (mahpratu.htm.txt) 28305259 (0.042):
evampramukhaiś caturaśītibhir bodhisattvakoṭīniyutaśatasahasraiḥ | / [4] sambahulaiś ca mahāśrāvakaiḥ sarvair arhadbhiḥ kṣīṇāsravair
Manjusrimulakalpa (bsu041_u.htm.txt) 11335353 (0.044):
anekayakṣakoṭīniyutaśatasahasraparivāritaistatraiva mahāparṣanmaṇḍale
Mahasannipataratnaketudharanisutra, or Ratnaketuparivarta (=RKP) (ratnakeu.htm.txt) 5194824 (0.046):
mahāsattvaiḥ koṭīnaytutaśatasahasraiḥ sārdhaṃ
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9088809 (0.048):
pūjayet / asmākaṃ caturṇāṃ mahārājānāmanekāni / yakṣakoṭīniyutaśatasahassrāṇyanena dharmaśravaṇenainena dharmāmṛtarasena
Manjusrimulakalpa (bsu041_u.htm.txt) 11333510 (0.048):
abjoṣṇīṣapramukhairanantanirhāradharmameghaniṣyandasamādhibhūtairanekaśatasahasra / koṭīniyutavidīpaparivāritairanekaiśca
Manjusrimulakalpa (bsu041_u.htm.txt) 11335377 (0.048):
ye 'pi te mahārākṣasarājānaḥ, anekarākṣasakoṭīniyutaśatasahasraparivārāḥ
Mahapratisara vidyarajni (= Mp) (mpratpru.htm.txt) 14251309 (0.049):
/ īśānena ca sapatnikena / anekagaṇakoṭīniyutaśatasahasraparivāreṇa //
Mahapratisaramahavidyarajni (mahpratu.htm.txt) 28305486 (0.049):
sapatnīkena anekagaṇakoṭīniyutaśatasahasraparivāreṇa | nārāyaṇena ca
Pañcaviṃśatisāhasrikā Prajñāpāramitā I (psp_1u.htm.txt) 15068419 (0.049):
smṛtimantaḥ saṃprajānānā anekair devakoṭīniyutaśatasahasraiḥ parivṛtāḥ
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6905563 (0.049):
06304 smṛtimantaḥ saṃprajānanto anekair devakoṭīniyutaśatasahasraiḥ
tenopasamakrāmad / ñ1.3 upasaṃkramya bhagavataḥ pādau śirasā vanditvā bhagavantaṃ
Carmavastu of the Vinayavstvagama of the Mulasarvastivadin (= Vastu 5 of (vinv05_u.htm.txt) 20886004 (0.0):
yena bahagvāṃs tenopasaṃkramya bhagavataḥ pādau śirasā vanditvaikānte
Divyavadana (divyav_u.htm.txt) 21536335 (0.0):
051.005. śrutvā ca punaryena bhagavāṃstenopasaṃkrāntaḥ/ / 051.005. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21538474 (0.0):
śrtāvastīnivāsino vaṇijo yena bhagavāṃstenopasaṃkrāntāḥ/ / 058.007. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānto niṣaṇṇāh
Divyavadana (divyav_u.htm.txt) 21546310 (0.0):
sopānenāvatīrya yena bhagavāṃstenopasaṃkrāntaḥ/ / 080.013. upasaṃkramya bhagavataḥ pādau śirasā vanditvā bhagavataḥ
Divyavadana (divyav_u.htm.txt) 21549750 (0.0):
khaḍgamaṇiṃ vālavyajanaṃ citre copānahau, sa pañca kakudānyapanīya yena / bhagavāṃstenopasaṃkrāntaḥ/ / 091.013. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21550265 (0.0):
pādābhyāmeva ārāmaṃ praviśya yena bhagavāṃstenopasaṃkrāntaḥ/ / 092.028. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21552112 (0.0):
098.013. atha te ṛṣayo yena bhagavāṃstenopasaṃkrāntāḥ/ / 098.014. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte sthitāḥ/
Divyavadana (divyav_u.htm.txt) 21553029 (0.0):
101.008. anekāni prāṇiśatasahasrāṇyativarṣeṇa bādhyamānāni yena / bhagavāṃstenopasaṃkrāntāḥ/ / 101.009. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇāni/
Divyavadana (divyav_u.htm.txt) 21556888 (0.0):
niṣkramya yena bhagavāṃstenopasaṃkrāntāḥ/ / 113.017. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇāḥ/
Divyavadana (divyav_u.htm.txt) 21557726 (0.0):
115.030. athāyuṣmān svāgato 'śvatīrthanāgamādāya yena / bhagavāṃstenopasaṃkrāntaḥ/ / 115.031. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21558089 (0.0):
117.001. śrutvā ca punaḥ śrāvastyā niṣkramya yena / bhagavāṃstenopasaṃkrāntaḥ/ / 117.002. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21559305 (0.0):
bhagavāṃstenopasaṃkrāntaḥ/ / 120.026. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21560197 (0.0):
prakṣālya yena bhagavāṃstenopasaṃkrāntāḥ/ / 124.002. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇāḥ/
Divyavadana (divyav_u.htm.txt) 21560962 (0.0):
126.028. athāyuṣmānānandaḥ sāyāhṇe 'bhisamlayanādvyutthāya yena / bhagavāṃstenopasaṃkrāntaḥ/ / 126.028. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte 'sthād/
Divyavadana (divyav_u.htm.txt) 21561644 (0.0):
caityamupaniśritya viharanti, tān sarvānupasthānaśālāyāṃ saṃnipātya yena / bhagavāṃstenopasaṃkrāntaḥ/ / 128.029. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte 'sthāt/
Divyavadana (divyav_u.htm.txt) 21568595 (0.0):
149.010. athāsau dharmaruciryena bhagavāṃstenopasaṃkrāntaḥ/ / 149.011. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte nyaṣīdat/
Divyavadana (divyav_u.htm.txt) 21576542 (0.0):
174.009. atha jyotiṣko gṛhapatiḥ suhṛtsambandhibāndhavānavalokya yena / bhagavāṃstenopasaṃkrāntaḥ/ / 174.010. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21581357 (0.0):
189.003. putra gaccha, bhagavantaṃ pṛccha/ / 189.003. yena bhagavāṃstenopasaṃkrāntaḥ/ / 189.004. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
Divyavadana (divyav_u.htm.txt) 21582023 (0.0):
190.030. gaccha, bhagavantaṃ pṛccha/ / 190.030. sa yena bhagavāṃstenopasaṃkrāntaḥ/
Divyavadana (divyav_u.htm.txt) 21582272 (0.0):
upanimantrya bhojayeyam/ / 191.021. iti viditvā yena bhagavāṃstenopasaṃkrāntaḥ/ / 191.022. upasaṃkramya bhagavataḥ pādau śirasā vanditvā ekānte niṣaṇṇaḥ/
pradakṣiṇīkṛtvā\var{
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540314 (0.052):
trāṇam śaraṇam parāyaṇaṃ bhavāmi yat\var{yat\lem \Dutt; yaḥ \cod} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540530 (0.054):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
Mahasitavati vidyarajni (msitvatu.htm.txt) 4477327 (0.055):
tenopasaṃkrānta upasaṃkramya bhagavataḥ pādau śirasā vanditvā bhagavantaṃ / tripradakṣiṇīkṛtya bhagavataḥ purato rudann aśrūṇi pravartayati sma /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540586 (0.055):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9082886 (0.057):
bhagavataḥ pādau śirasā vanditvā bhagavantaṃ tripradakṣiṇīkṛtyaikānte
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540278 (0.059):
yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
Mahavastu-Avadana (mhvastuu.htm.txt) 18697357 (0.061):
bhagavato tūṣṇībhāvenādhivāsanāṃ viditvā bhagavataḥ pādau śirasā vanditvā / bhagavantaṃ triṣkṛtyo pradakṣiṇīkṛtvā tatraivāntarahāyensuḥ //
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19050916 (0.063):
sādhu bhagavann ity āyuṣmān ānando bhagavataḥ pādau śirasā vanditvā / bhagavantaṃ triḥpradakṣiṇīkṛtya yena svātir bhikṣus tenopasaṃkramya svāter
Divyavadana (divyav_u.htm.txt) 21616591 (0.063):
pādau śirasā vanditvā bhagavantaṃ triḥ pradakṣiṇīkṛtya bhagavato 'ntikāt
Divyavadana (divyav_u.htm.txt) 21616686 (0.063):
316.028. atha prakṛtermātaṅgadārikāyā mātāpitarau bhagavataḥ pādau śirasā / vanditvā bhagavantaṃ triḥ pradakṣiṇīkṛtya bhagavato 'ntikātprakrāntau//
Sardulakarnavadana (divav33u.htm.txt) 6625149 (0.063):
pādau śirasā vanditvā bhagavantaṃ triḥpradakṣiṇīkṛtya bhagavato +antikāt
Sardulakarnavadana (divav33u.htm.txt) 6625254 (0.063):
p.7.4/.atha prakṛter mātaṅga^dārikāyā mātāpitarau bhagavataḥ pādau śirasā / vanditvā bhagavantaṃ triḥpradakṣiṇīkṛtya bhagavato +antikāt prakrāntau/
Nagaropamasutra (nagsu_tu.htm.txt) 15617452 (0.063):
bhagavatpādau śirasā vanditvā bhagavantaṃ tṛpradakṣiṇīkṛtvā
Nagaropamasutra (nagsu_tu.htm.txt) 15618452 (0.063):
NagSū II.27 idaṃ vaditvā catvāro mahārājāno bhagavatpādau śirasā vanditvā / bhagavantaṃ tṛpradakṣiṇīkṛtvā tatraivāntarhita
Mahavastu-Avadana (mhvastuu.htm.txt) 18799589 (0.064):
kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ pratiṣṭhāpya bhagavataḥ pādau śirasā / vanditvā bhagavantaṃ trikhuttaṃ pradakṣiṇīkṛtvā bhagavato pṛṣṭhato asthāsi
Divyavadana (divyav_u.htm.txt) 21559561 (0.064):
bhagavataḥ pādau śirasā vanditvā bhagavantaṃ triḥ pradakṣiṇīkṛtya / prāñjalikṛtasampuṭo bhagavantaṃ namasyamānastatraivāntarhitaḥ//
bhagavantam etad avocat / / ñ1.4 idaṃ mama bhagavann ekādaśamukhaṃ nāma hṛdayam ekādaśabhi
Ekadasamukham (bsu015_u.htm.txt) 21404802 (0.033):
bhagavantaṃ pradakṣiṇīkṛtyaekānte nyasīda bhagavantametadavocat / idaṃ / mama bhagavannekādaśamukhaṃ nāma hṛdayamekādaśabhiḥ kalpakoṭībhirbhāṣitam
Amoghapasahrdayasutra (amoghapu.htm.txt) 16994384 (0.036):
bhagavāṃs tenāñjaliṃ kṛtvā praṇamya prahasitavadano bhūtvā bhagavantam / etad avocat* / asti mama bhagavan amoghapāśarājaṃ nāma hṛdayaṃ yan mayā
Divyavadana (divyav_u.htm.txt) 21572755 (0.041):
162.007. dṛṣṭvā ca punaḥ patnīmādāya yena bhagavāṃstenopasaṃkrāntaḥ/ / 162.008. upasaṃkramya bhagavantamidamavocat bhagavan, iyaṃ me patnī
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 3996982 (0.048):
atha khalvāyuṣmān śāriputro bhagavantametadavocat mamāpi bhagavan / pratibhātiyenārthena bodhisattvo mahāsattva ityucyate / bhagavānāha
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19032287 (0.051):
bhagavantametadavocat / asti bhagavan abhayatejaṃ nāma dhāraṇī
Divyavadana (divyav_u.htm.txt) 21616520 (0.053):
316.012. ekāntasthita āyucmānānando bhagavantamidamavocat iyaṃ me / bhagavan prakṛtirmātaṅgadārikā pṛṣṭhataḥ pṛṣṭhataḥ samanubaddhā
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4026847 (0.057):
atha khalvāyuṣmān śāriputro bhagavantametadavocat ko'tra bhagavan / adhimokṣayiṣyati evaṃgambhīrāyāṃ prajñāpāramitāyām? bhagavānāha yaḥ
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19034518 (0.059):
pradakṣiṇīkṛtya pādaryonipatya bhagavantametadavocat / ahamapi / bhagavaṃstathāgatādhiṣṭhānena pratijñāṃ kariṣyāmi
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4046850 (0.060):
pratiṣṭhāpya yena bhagavāṃstenāñjaliṃ praṇamya bhagavantametadavocat / ahaṃ bhagavan atra sthāne notrasiṣyāmi, na saṃtrasiṣyāmi, na
Mahavastu-Avadana (mhvastuu.htm.txt) 18649770 (0.060):
[_Mvu_1.318_] bhagavantam etat avocat* // ihāhaṃ bhagavantaṃ addaśāmi
Lalitavistara (bsu022_u.htm.txt) 9841285 (0.060):
atha khalvāyuṣmānānando buddhānubhāvena bhagavantametadavocat āścaryaṃ / bhagavan yāvajjugupsanīyaśca mātṛgrāmastathāgatenokto yāvadrāgacaritaśca /
Karandavyuha (bsu019_u.htm.txt) 7108098 (0.060):
atha sarvanīvaraṇāviṣkambhī bhagavantametadavocat - gamiṣyāmyahaṃ bhagavan
Vajracchedika Prajnaparamita (vchedpgu.htm.txt) 10049688 (0.062):
āyuṣmāṃ subhūtir dharmapravegenāsrūṇi prāmuṃcat so 'srūṇi prāmṛjya / bhagavantam etad avocat* āścaryaṃ / 6. bhagavan paramāścaryaṃ sugata | yāvad ayaṃ dharmaparyāyas tathāgatena
Astadasasahasrika Prajnaparamita, Parivartas 55 - 70 (first part) (adsp55-u.htm.txt) 23096414 (0.062):
sarvākārajñatāmanasikārāt. athāyuṣmān ānando bhagavantam etad avocat: kina / punar bhagavan sarvān bodhisattvān mahāsattvān māraḥ pāpīyān upasaṃkrāmati
Pancavimsatisahasrika Prajnaparamita, VI-VIII (psp_6-8u.htm.txt) 9798337 (0.062):
atha khalv āyuṣmān subhūtir bhagavantam etad avocat: kathaṃ bhagavann evam / asaṃbhinneṣu dharmeṣv ānimitteṣu lakṣaṇaśūnyeṣu
Vimalakirtinirdesa (bsu061_u.htm.txt) 23914592 (0.062):
evamukte, bhagavantamāyuṣmāṃśāriputra etadavocat- bhagavan
Samghatasutra (alternative version). (samghscu.htm.txt) 17097991 (,0.063):
pratiṣṭhāpya
bauddha_aai_xvi.r.o.combined 14532075 (0.063):
atha khalv āyuṣmān subhūtir bhagavantam etad avocat / / yad bhagavān evam āha / durabhisambhavānuttarā samyak=
[kalpako]ṭībhir bhāṣitam / / ñ1.5 ahaṃ caitarhi\var{caitarhi\lem \cod; cet tarhi \Dutt} bhāṣiṣyāmi
sarva[sattvānā]m arthāya hitāya sukhāya sarvavyādhipraśa[ma]nāya{ḥ}
Ekadasamukham (bsu015_u.htm.txt) 21404819 (0.009):
/ ahaṃ cettarhi bhāṣiṣyāmi sarvasattvānāmarthāya hitāya sukhāya
Grahamatrkanamadharani (grahmdhu.htm.txt) 26664110 (0.013):
bhagavān āha - sādhu sādhu vajrapāṇe yas tvaṃ sarvasattvānām arthāya / hitāya sukhāya kṛpācittam utpādya mahāguhyātiguhyataraṃ tathāgataṃ
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444366 (0.013):
mahākaruṇikāya sādhukāramadāt - sādhu sādhu kulaputra, yastvaṃ / sarvasattvānāmarthāya hitāya sukhāya pradhānāya ca dīrgharātraṃ niyuktaḥ |
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9091666 (0.014):
upasaṃkramitvā tāni prasannacittāni sarvasattvānāmarthāya hitāya sukhāya
Manjusrimulakalpa (bsu041_u.htm.txt) 11421085 (0.016):
/ etarhi ahaṃ ca bhāṣiṣye sarvasattvānāmarthāya hitāya sukhāya
Sarvadurgatiparisodhana Tantra (sdurst_u.htm.txt) 25307703 (0.016):
api bhagavan sarvasattvānām arthāya hitāya sukhāya svakasvakāni hṛdayāni
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444422 (0.016):
- tena hi sugata bhāṣatu sarvasattvānāmarthāya hitāya sukhāya ca ||
Manjusrimulakalpa (bsu041_u.htm.txt) 11456581 (0.017):
suṣṭhu ca manasi kuru / bhāṣiṣye 'haṃ te sarvasattvānāmarthāya hitāya
Manjusrimulakalpa (bsu041_u.htm.txt) 11389287 (0.021):
sarvasattvānāmarthāya hitāya sukhāya lokānukampāyai mahato janasyārthāya
Ratnakarasanti: Bhramaharanama Hevajrasadhana (rabhramu.htm.txt) 19553697 (0.024):
abhisaṃbudheya sarvasattvānām arthāya hitāya sukhāya yāvad atyantaniṣṭhe
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19032164 (0.027):
adhiṣṭhitāni mayāpyetarhi bhāṣitā[ni] sarvasattvānāmarthāya hitāya sukhāya
Samghatasutra (bsu045_u.htm.txt) 7833754 (0.031):
(sarva)sattvānāmarthāya hitāya sukhāya (ca) pratipanno bhavati / sattvān
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19035018 (0.036):
sādhu bhagini sādhu khalu punastvaṃ bhagini yattvaṃ sarvasattvānāṃ hitāya / sukhāya pratipannā asyaiva ca dharmaparyāyasya cirasthityarthaṃ (Dutt 78)
Manjusrimulakalpa (bsu041_u.htm.txt) 11434024 (0.036):
buddho svamantraṃ ca / yā cāsmākamanukampārthaṃ sarvasattvānāṃ ca hitāya / sukhāya svamantracaryāt //
Vasudharadharani (=Vasudharadharanisutra) (vadhdhdu.htm.txt) 21849032 (0.039):
nānāvyādhiparipīḍitānāṃ sarvaduṣṭasattvabhayopadrutānām arthāya hitāya / sukhāya saṃbhogāya paribhogāya kṣemāya ceti | ānanda āha ḥ udgṛhītā me
Mahaparinirvanasutra (mpsu_w_u.htm.txt) 24467467 (0.052):
bahujanasukhāya (lokānu)kaṃpāyārthāya hitāya sukhāya devamanuṣyāṇām ||
Mahasitavati vidyarajni (msitvatu.htm.txt) 4477436 (0.053):
sarvasatvānāṃ ca dīrgharātram arthāya hitāya sukhāya yogakṣemāya
Bodhisattvapratimoksasutra (bsu011_u.htm.txt) 24248950 (0.054):
vyavacāryya upāyakauśalyaṃ vā śikṣiṣye tat sarvvasattvānāmarthāya hitāya / sukhāya //
Bhaisajyaguruvaiduryaprabharajasutra (bsu012_u.htm.txt) 8362163 (0.057):
sarvasattvānām arthāya hitāya sukhāya autsukyaṃ kariṣyāmaḥ | yo viśeṣeṇa
Saddharmapundarikasutra (bsu036_u.htm.txt) 6564174 (0.057):
tāni bhagavato bhāṣitaṃ śraddhāsyanti pratīyiṣyanti udgahīṣyanti | teṣāṃ / tadbhabhaviṣyati dīrgharātramarthāya hitāya sukhāyeti ||
sarvapāpālakṣmīduḥsvapnapratinivāraṇāya sarvākālamṛtyupratinivāraṇāya
Ekadasamukham (bsu015_u.htm.txt) 21404832 (0.0):
sarvavyādhipraśamanāya sarvapāpālakṣmiduḥsvapnapratinivāraṇāya / sarvākālamṛtyupratinivāraṇāya aprasādānāṃ prasādanāya
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19032020 (0.023):
sarvakarmakṣayaṃkarāṇi sarvākālamṛtyuduḥsvapnasarvavyādhipraśamanakarāṇī
Sarvatathagatosnisasitatpatra-nama-aparitamahapratyangiravidyarajni (Sitatapatra) (bsu004_u.htm.txt) 14311723 (0.048):
sarvaparavidyācchedanīm / akālamṛtyuparitrāyaṇīm / / sarvasattvabandhanamokṣaṇīm / sarvaduḥsvapnanāśanīm / yakṣarākṣasagrahāṇāṃ
Sarvatathagatadhisthanavyuhasutra (bsu037_u.htm.txt) 19035505 (0.063):
saṃprakāśatitavyo manasā dhārayitavyaḥ / ḍimbaḍumaraduḥsvapnadurnimitteṣu / akālamṛtyugomarapaśumaramānuṣamarebhyo nānāvyādhibhayopadravebhya imaṃ
aprasādānāṃ prasādanāya sarvavighnavināyakānāṃ praśamanāya /
Ekadasamukham (bsu015_u.htm.txt) 21404836 (0.0):
sarvavyādhipraśamanāya sarvapāpālakṣmiduḥsvapnapratinivāraṇāya / sarvākālamṛtyupratinivāraṇāya aprasādānāṃ prasādanāya
ñ1.6 nā[haṃ] bhagava(n/t) samanupaśyāmi sadevake loke samārake sabrahmake
Arthaviniscayasutra (bsu005_u.htm.txt) 2958511 (5.960):
ityatra kaścidvādaṃ samāropayet sadevake loke samārake sabrahmake
Astadasasahasrika Prajnaparamita, Parivartas 70 (contd.) - 82 (adsp70-u.htm.txt) 15033463 (5.960):
me kaścit sadevake loke samārake sabrahmake sabrahmaṇa [brāṇikāyā]prajāyāṃ
Bower Manuscript. (bowermsu.htm.txt) 18509519 (5.960):
5 paśyatu śaradāśataṃ // na cāhaṃ tam ānanda samanupaśyāmi sadevake loke / samārake sabrahmake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ
Ekadasamukham (bsu015_u.htm.txt) 21404848 (5.960):
sarvavighnavināyakānāṃ praśamanāya / nāhaṃ bhagavan samanupaśyāmi (Em 36) / sadevake loke samārake sabrahmake saśramaṇabrāhmaṇikāyāḥ prajāyā yadanena
Gandavyuhasutra (bsu016_u.htm.txt) 28713536 (5.960):
anavadyo bhavati sarvajātaḥ / adoṣaḥ sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyām / kulīno bhavati uttamabuddhakulasaṃbhūto
Lalitavistara (bsu022_u.htm.txt) 9834874 (5.960):
bhavati sarvajātivādadoṣaiḥ sadevake loke samārake sabrahmake
Lalitavistara (bsu022_u.htm.txt) 9841775 (5.960):
khalu puna ratnavyūho bodhisattvaparibhoga evaṃ varṇasaṃsthāno yasya na / kaścit sadevake loke samārake sabrahmake sadṛśo 'sti ākṛtyā vā varṇena vā
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19041699 (5.960):
śaradāśataṃ. nāham ānanda samanupaśyāmi sadevake loke samārake sabrahmake
Mahavastu-Avadana (mhvastuu.htm.txt) 18771149 (5.960):
amohante saphalaṃ ca dharmo prakāśitaṃ yasya te sadṛśo nāsti sadevake loke / samārake sabrahmake saśramaṇabrāhmaṇavaṇīpake prajāyāṃ sadevamānuṣāsurāyāṃ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15249402 (5.960):
śāriputra samanupaśyāmi sadevake loke samārake sabrahmake
Pancavimsatisahasrika Prajnaparamita, VI-VIII (psp_6-8u.htm.txt) 9804726 (5.960):
pratijānata ime dharmā nābhisaṃbuddhā ity atra me kaścit sadevake loke / samārake, sabrahmake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ vā dharmā kopayed iti
Pratityasamutpadamahayanasutra (bsu026_u.htm.txt) 6216343 (5.960):
etatpariṣanmaṇḍalapatitāḥ kathamapi brahmacaryapuṇyaprasavāḥ sadevake / samārake sabrahmake loke saśramaṇabrāhmaṇaprajāsu bhikṣavo bhikṣuṇyaḥ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6611198 (5.960):
| na tava kulaputra sadevake loke samārake sabrahmake
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6178700 (5.960):
gurukṛtya mānayitvā pūjayitvopaniśrāya vihareyaṃ so 'haṃ kauśika sadevake / loke samārake sabrahmake saśravaṇabrāhmaṇikāyāṃ prajāyāṃ
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9081989 (5.960):
bhagavataḥ śākyamunerāyuḥpramāṇam / tatkasya hetoḥ / na ca vai kulaputra / taṃ samanupaśyāmaḥ sadevake loke samārake sabrahmake
Vasudharadharani (= Vasudharadharanisutra) (vadhdhju.htm.txt) 16512816 (5.960):
nāhaṃ ānaṃda taṃ dharme samanupaśyāmi sadevake loke samārake sabrahmake
Vasudharadharani (=Vasudharadharanisutra) (vadhdhdu.htm.txt) 21848960 (5.960):
manuṣyāṇāṃ ca nāham ānanda taṃ dharmaṃ samanupaśyāmi | sadevake loke / samārake sabrahmake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ sadevāsuramānuṣyāṇāṃ
Vasudharadharani or Sucandragrhapatipariprccha or Sucandravadana (vadhdhgu.htm.txt) 25797861 (0.032):
devamanuṣyāṇāṃ / nāham ānanda samanupaśyāmi sadevake loke samārake
Arthaviniscayasutra (bsu005_u.htm.txt) 2958596 (0.033):
kaścidvādamāropayet sadevaloke samārake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6163305 (0.040):
samanupaśyāmi, sadevaloke samārake sabrahmake saśravaṇabrāhmaṇikāyāṃ
saśramaṇabrāhmaṇikāyā<ḥ> prajāyā, yad anena hṛdayena rakṣe kṛte paritre
Ekadasamukham (bsu015_u.htm.txt) 21404855 (0.010):
sadevake loke samārake sabrahmake saśramaṇabrāhmaṇikāyāḥ prajāyā yadanena / hṛdayena rakṣe kṛte paritre parigrahe śāntisvastyayane daṇḍaparihare
Mahavastu-Avadana (mhvastuu.htm.txt) 18771151 (0.037):
amohante saphalaṃ ca dharmo prakāśitaṃ yasya te sadṛśo nāsti sadevake loke / samārake sabrahmake saśramaṇabrāhmaṇavaṇīpake prajāyāṃ sadevamānuṣāsurāyāṃ
Arthaviniscayasutra (bsu005_u.htm.txt) 2958515 (0.054):
ityatra kaścidvādaṃ samāropayet sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyāṃ sadevamānuṣāyām |
Arthaviniscayasutra (bsu005_u.htm.txt) 2958600 (0.054):
kaścidvādamāropayet sadevaloke samārake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ / sadevamānuṣāyāṃ nimittamevaṃ na samanupaśyati | nimitta(ma)samanupaśyan
Bower Manuscript. (bowermsu.htm.txt) 18509518 (0.060):
5 paśyatu śaradāśataṃ // na cāhaṃ tam ānanda samanupaśyāmi sadevake loke / samārake sabrahmake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ
Ekadasamukham (bsu015_u.htm.txt) 21404847 (0.060):
sadevake loke samārake sabrahmake saśramaṇabrāhmaṇikāyāḥ prajāyā yadanena
Gandavyuhasutra (bsu016_u.htm.txt) 28713535 (0.060):
anavadyo bhavati sarvajātaḥ / adoṣaḥ sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyām / kulīno bhavati uttamabuddhakulasaṃbhūto
Lalitavistara (bsu022_u.htm.txt) 9834873 (0.060):
bhavati sarvajātivādadoṣaiḥ sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyām / ebhirmārṣāścatuṣṣaṣṭyākāraiḥ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15249401 (0.060):
śāriputra samanupaśyāmi sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyām imāṃ prajñāpāramitām upārambhābhiprāyaḥ
Pancavimsatisahasrika Prajnaparamita, VI-VIII (psp_6-8u.htm.txt) 9804725 (0.060):
pratijānata ime dharmā nābhisaṃbuddhā ity atra me kaścit sadevake loke / samārake, sabrahmake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ vā dharmā kopayed iti
Pratityasamutpadamahayanasutra (bsu026_u.htm.txt) 6216343 (0.060):
samārake sabrahmake loke saśramaṇabrāhmaṇaprajāsu bhikṣavo bhikṣuṇyaḥ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6611197 (0.060):
| na tava kulaputra sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyāṃ sadṛśo vidyate tathāgatamekaṃ vinirmucya |
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9081988 (0.060):
taṃ samanupaśyāmaḥ sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyāṃ sadevamānuṣāsurāyāṃ yaḥ samarthaḥ
Vasudharadharani (= Vasudharadharanisutra) (vadhdhju.htm.txt) 16512815 (0.060):
nāhaṃ ānaṃda taṃ dharme samanupaśyāmi sadevake loke samārake sabrahmake / saśramaṇabrāhmaṇikāyāṃ prajāyāṃ sadevamānuṣāsurāyāṃ ca imāṃ vasudhārā nāma
Vasudharadharani (=Vasudharadharanisutra) (vadhdhdu.htm.txt) 21848959 (0.060):
manuṣyāṇāṃ ca nāham ānanda taṃ dharmaṃ samanupaśyāmi | sadevake loke / samārake sabrahmake saśramaṇabrāhmaṇikāyāṃ prajāyāṃ sadevāsuramānuṣyāṇāṃ
parigra[he śā]ntisvastyayane daṇḍaparihare śastraparihare
Ekadasamukham (bsu015_u.htm.txt) 21404862 (0.048):
hṛdayena rakṣe kṛte paritre parigrahe śāntisvastyayane daṇḍaparihare / śastraparihare viṣaprahāṇe kṛte yaḥ kaścidatikramet na praśamet
viṣadūṣaṇe\var{viṣa[dūṣa]ṇe \em \Hidas; viṣa[prahā]ṇe \em\Dutt} kṛte yaḥ
kaś cid atikrame na praśame, nedaṃ [sthā]na<ṃ> vidyate; sthāpya paurāṇāṃ
Ekadasamukham (bsu015_u.htm.txt) 21404875 (0.059):
nedaṃsthānaṃ vidyate sthāptya paurāṇāṃ karma vipacyate / tadasya ca
karma vipacyat tad asya ca kalpayato 'bhiśraddadhataḥ sarveṇa sarvaṃ na
Ekadasamukham (bsu015_u.htm.txt) 21404883 (0.0):
nedaṃsthānaṃ vidyate sthāptya paurāṇāṃ karma vipacyate / tadasya ca / kalpayato 'bhiśraddadhataḥ sarveṇa sarvaṃ na bhaviṣyati /
Vinayasutra (vinsutru.htm.txt) 23010190 (0.028):
Vin_2.49 / tad antyoktāvantaraṇam abhisaṃhitaṃ yenā[8b2]ntaritasya na / sarveṇa sarvam asaṃbhāvanaṃ spṛṣṭeḥ /
Sravakabhumi (srabhu_u.htm.txt) 15196059 (0.032):
cittaṃ vimuktaṃ na tu sarveṇa sarvam anuśayebhyaḥ, tatpratipakṣāś ca me
Asanga: Sravakabhumi (srabhusu.htm.txt) 6325862 (0.035):
saṃskārāṇāṃ sarveṇa sarvamapravṛttirupalabhyate | tadyathā / kvāthyamānāmasāmante sarveṇa sarvamparikṣayo bhavati agninirdagdhānāṃ ca
Divyavadana (divyav_u.htm.txt) 21649296 (0.036):
456.019. śyāmāvatī kathayati deva, mā kṣepsyasi/ / 456.019. mā sarveṇa sarvaṃ na bhaviṣyatīti/
SATAPATHA-BRAHMANA 2 (sb_02_u.htm.txt) 10033153 (0.038):
etadamṛtamantarātmannādhatte nāmṛtatvasyāśāsti sarvamāyuretyastaryo haiva / bhavati na hainaṃ sapatnastustūrṣamāṇaścana stṛṇute
Kesava: Kausikapaddhati (keskaupu.htm.txt) 1818648 (0.038):
tata uttaratantram | vaṇijādiartharatnadhānyaputralābho'sti sarvaṃ / vaṇijyotiparimuccairbhavati tataḥ kuryāt | 'indramahaṃ vaṇijam' iti
Gautama: Nyayasutra (nystik_u.htm.txt) 2447691 (0.043):
yanmūrtimattena sarveṇasambadhyate / / mūrtimatā sarveṇa sambaddhattvaṃ sarvatatvaṃ vadato
Bodhisattvabhumi (bsa034_u.htm.txt) 24863210 (0.045):
tāḍayiṣyāmi vā sarvasvena vā viyojayiṣyāmi sarveṇa vā sarva vijitāt / pravāsayiṣyāmīti / tatra ca karmaṇi kuśalān dakṣān pauruṣeyānviniyojayati
% Mahabharata, Parvans 1 - 18 (mbh1-18u.htm.txt) 19684538 (0.045):
01,151.001d@092_0039 tāvad eva hi bhokṣye 'haṃ durlabhaṃ vai punar bhavet / 01,151.001d@092_0040 viprakīryeta sarvaṃ hi prayuddhe mayi rakṣasā
% Mahabharata: Santiparvan (mbh_12_u.htm.txt) 10288071 (0.046):
12,074.012c tayoḥ saṃdhir bhidyate cet purāṇas; tataḥ sarvaṃ bhavati hi / saṃpramūḍham / 12,074.013a nātra plavaṃ labhate pāragāmī; mahāgādhe naur iva saṃpraṇunnā
Gautama: Nyayasutra (nystik_u.htm.txt) 2439512 (0.046):
anyathā temūkataiva syāditi / / tadidamuktaṃ sarvaṃ cāmimittaṃ pratipādayasi ceti vyāhatam /
Divyavadana (divyav_u.htm.txt) 21541249 (0.047):
kṣipati, sarveṇa vā sarvaṃ jīvitādvyaparopayati/ / 066.003. nīlodaṃ mahāsamudraṃ samatikramya nīlodo nāma mahāparvataḥ/
Divyavadana (divyav_u.htm.txt) 21574209 (0.048):
sarveṇa sarvaṃ na bhaviṣyasīti/ / 167.008. sa na pratigṛhṇāti/
VATSYAYANA: KAMASUTRA (with notes) (kamasufu.htm.txt) 27929789 (0.049):
3.1.18 snānādiṣu niyujyamānā varayitāraḥ sarvaṃ bhaviṣyatīty uktvā na
Jayaditya & Vamana: Kasikavrtti (jvkasixu.htm.txt) 7460956 (0.051):
gurūpottamādikaṃ sarvam asti iti na staṇiñau / / ṭiḍḍhāṇañ (*4,1.15) iti ṅīb eva bhavati /
Larger Prajnaparamita (pplg1__u.htm.txt) 27754310 (0.053):
jānakaḥ paśyakaḥ sparśako vijānakaḥ sarva ete yathābhūtaṃ parigaveṣyamāṇāḥ / sarveṇa sarvan nopalabhyante | anupalaṃbhaśunyatām upādāya | yāvad eva
Sravakabhumi (srabhu_u.htm.txt) 15173409 (0.058):
api cāsyaivaṃ bhavati / aho batāhaṃ buddhānujñātāṃ jāgarikāṃ sarveṇa / sarvaṃ sarvathā saṃpādayeyam" iti / tasyāś ca saṃpādanārthaṃ bhrśaṃ"
Asanga: Sravakabhumi (srabhusu.htm.txt) 6284848 (0.061):
pūrvikā, purāṇā manāpatā (na āpatā) tāṃ sarveṇa sarvaṃ vijahāti | parāṃ ca
Bodhisattvabhumi (bsa034_u.htm.txt) 24875405 (0.063):
pramudite [vihāre] āpāyikakleśapakṣyasya sarveṇa sarvaṃ / samudācāratastvadhimātramamyasya sarvakleśapakṣyasya anābhoge nirnimitte
bhaviṣyati / / ñ1.8 sarvabuddhastutaḥ samanvāhṛto 'yaṃ hṛdaya<ṃ>. sarvatathāgatānumodito
Ekadasamukham (bsu015_u.htm.txt) 21404890 (1.788):
kalpayato 'bhiśraddadhataḥ sarveṇa sarvaṃ na bhaviṣyati /
Divyavadana (divyav_u.htm.txt) 21649296 (0.027):
456.019. śyāmāvatī kathayati deva, mā kṣepsyasi/ / 456.019. mā sarveṇa sarvaṃ na bhaviṣyatīti/
Sravakabhumi (srabhu_u.htm.txt) 15196059 (0.027):
cittaṃ vimuktaṃ na tu sarveṇa sarvam anuśayebhyaḥ, tatpratipakṣāś ca me
Divyavadana (divyav_u.htm.txt) 21574209 (0.033):
sarveṇa sarvaṃ na bhaviṣyasīti/ / 167.008. sa na pratigṛhṇāti/
Vinayasutra (vinsutru.htm.txt) 23010190 (0.042):
Vin_2.49 / tad antyoktāvantaraṇam abhisaṃhitaṃ yenā[8b2]ntaritasya na / sarveṇa sarvam asaṃbhāvanaṃ spṛṣṭeḥ /
Mahavastu-Avadana (mhvastuu.htm.txt) 18697761 (0.054):
vācikena sthāmena samanvāgatā bhavanti na tāvat sarveṇa sarvaṃ cetasikena
Vimalakirtinirdesa (bsu061_u.htm.txt) 23915509 (0.054):
tvayā sarvabuddhānudhvaṃsanam (kṛtaṃ syāt), sarvabuddhadharmākīrti kṛtvā,
Sravakabhumi (srabhu_u.htm.txt) 15173409 (0.055):
api cāsyaivaṃ bhavati / aho batāhaṃ buddhānujñātāṃ jāgarikāṃ sarveṇa / sarvaṃ sarvathā saṃpādayeyam" iti / tasyāś ca saṃpādanārthaṃ bhrśaṃ"
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6972718 (0.057):
26020 bhaviṣyati/ tat kasya hetoḥ/ tathā hi te bodhisattvāḥ sarveṇa sarvaṃ / sarvathā sarvaṃ
Divyavadana (divyav_u.htm.txt) 21528282 (0.058):
023.027. sacet tvāṃ pūrṇa śroṇāparāntakā manuṣyāḥ sarveṇa sarvaṃ jīvitād / vyaparopayiṣyanti, tasya te kathaṃ bhaviṣyati? sacenmāṃ bhadanta
Gautama: Nyayasutra (nystik_u.htm.txt) 2447689 (0.059):
yanmūrtimattena sarveṇasambadhyate / / mūrtimatā sarveṇa sambaddhattvaṃ sarvatatvaṃ vadato
Vasubandhu: Bodhicittotpadasutrasastra (vasbocpu.htm.txt) 2589107 (0.059):
saṃkṣepata ucyate | buddhadharmasaṃghadṭaṣṭirnirvāṇadṭaṣṭirevaṃ / yatkiñcatprāptavyadṭaṣṭiḥ sarvameṣa āsaṅga | cittāsaṃga evocyate
Asanga: Sravakabhumi (srabhusu.htm.txt) 6284878 (0.060):
manasi kuryāt samanusmarennāsya sarveṇa sarvamanyatrāpi tāvadavipariṇate,
Sravakabhumi (srabhu_u.htm.txt) 15169827 (0.060):
118) manasikuryāt samanusmaret, nāsya sarveṇa sarvam anyatrāpi tāvad / avipariṇate, praṇīte bhojane bhogakāmatā saṃtiṣṭheta, kaḥ punar vādas
Divyavadana (divyav_u.htm.txt) 21541249 (0.061):
kṣipati, sarveṇa vā sarvaṃ jīvitādvyaparopayati/ / 066.003. nīlodaṃ mahāsamudraṃ samatikramya nīlodo nāma mahāparvataḥ/
Bodhisattvabhumi (bsa034_u.htm.txt) 24875405 (0.062):
pramudite [vihāre] āpāyikakleśapakṣyasya sarveṇa sarvaṃ / samudācāratastvadhimātramamyasya sarvakleśapakṣyasya anābhoge nirnimitte
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6963918 (0.062):
vidyate nopalabhyate/ evaṃ hi / 24423 bhagavan sarveṇa sarvaṃ sarvathā sarvaṃ bodhisattvam anupalabhamāno
Asanga: Mahayanasutralankara (asmahsuu.htm.txt) 4637378 (0.062):
tasminneṣā vyavasitirniścayo bhavati naivedaṃ buddhavacanamitie | / atrāsapadasthānatve ślokaḥ |
Asanga: Mahayanasutralamkara, with Vasubandhu's commentary (asmahsbu.htm.txt) 11294318 (0.062):
katham asati tasminn eṣā vyavasitir niścayo bhavati naivedaṃ buddhavacanam / iti | atrāsapadasthānatve ślokaḥ |
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6964072 (0.062):
vijñānaṃ bodhisattva iti/ evam api na vidyate nopalabhyate/ evaṃ hi / bhagavan sarveṇa sarvaṃ sarvathā sarvaṃ bodhisattvam anupalabhamāno
'yaṃ hṛdayaṃ\var{hṛdayaṃ\lem \em; hṛdaye \cod}/
ñ1.9 smarāmy ahaṃ bhagavaṃ gaṅgānadībālukāsamānāṃ kalpānāṃ pareṇa
Ekadasamukham (bsu015_u.htm.txt) 21404903 (0.008):
hṛdayam / smarāmyahaṃ bhagavan gaṅgānadīvālukāsamānāṃ kalpānāṃ pareṇa
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540225 (0.022):
smarāmy ahaṃ bhagavann it daśānāṃ gaṅgānadībāl[u]kāsamānāṃ kalpānāṃ tataḥ / pareṇa paratareṇa mandāravagandho nāma tathāgato 'bhūt{a} /
Ekadasamukham (bsu015_u.htm.txt) 21405040 (0.025):
smarāmyahaṃ bhagavanniti daśānāṃ gaṅgānadīvālukāsamānāṃ kalpānāṃ tataḥ
Karunapundarikasutra (bsu018_u.htm.txt) 7677510 (0.039):
/ (KpSū 372) evaṃ ca me āśā paripūrṇā gaṅgānadīvālikāsamānāṃ / mahākalpānāmantareṇa sārthavāho 'bhūvan, gaṅgānadīvālikāsameṣu śūnyeṣu
Samghatasutra (bsu045_u.htm.txt) 7821273 (0.043):
draṣṭavyaṃ / / bhagavānāha / yathā gaṃgānadībālukāsamānāṃ tathāgatānāṃ arhatāṃ
Samghatasutra (alternative version). (samghscu.htm.txt) 17087131 (0.046):
draṣṭavyaṃ? 2. bhagavān āha: yathā gaṃgānadīvālukāsamānāṃ tathāgatānāṃ
Srimahadevivyakaranam (bsu007_u.htm.txt) 7926232 (0.046):
bhagavan śriyā mahādevyā kuśalamūlamavaropitam / bhagavānāha / / gaṃgānadīvālukāsamānāṃ tathāgatānāmantikāt śriyā mahādevyā
Kasyapaparivartasutra (bsu020_u.htm.txt) 23696247 (0.054):
dadyāt / gaṅgānadīvālukasamānāṃ ca buddhā................... bhagavantānām
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9088143 (0.055):
buddhakṣetrakoṭīniyutaśatasahasreṣvanekeṣāṃ gaṅgānadīvālukāsamānāṃ / tathāgatakoṭīniyutaśatasahasrāṇāmuparyantarīkṣe tāni
Karunapundarikasutra (bsu018_u.htm.txt) 7656390 (0.058):
bhavasva / bhaviṣyasi tvaṃ gandhahaste 'tikrāntānāṃ / gaṅgānadīvālikāsamānāmasaṃkhyeyānāṃ avaśiṣṭe dvitīye nadīgaṅgāvālikāsame
Gandavyuhasutra (bsu016_u.htm.txt) 28618923 (0.059):
ekajanmanā aṣṭatriṃśadgaṅgānadīvālukāsamānāṃ tathāgatānāmantike
Aparimitayuhsutra (bsu003_u.htm.txt) 26128205 (0.061):
om namo bhagavate / tena khalu punaḥ samayena gaṅgānadīvālukopamānāṃ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6599997 (0.062):
aṣṭaṣaṣṭigaṅgānadīvālukāsamānāṃ / bodhisattvakoṭīnayutaśatasahasrāṇāmanutpattikadharmakṣāntirutpannā |
Kasyapaparivartasutra (kasyparu.htm.txt) 9791394 (0.063):
'rhadbhyaḥ samyaksaṃbuddhebhyo dānaṃ dadyāt* gaṃgānadīvālukasamānāṃ ca / buddhānāṃ / 4 bhagavantānām ekaikasya ca tathāgatasya gaṃgānadīvālukāsamān vihārān
Karunapundarikasutra (bsu018_u.htm.txt) 7671010 (0.063):
'dhvanyatikrāntānāmekagaṅgānadīvālikāsamānāmasaṃkhyeyānāṃ kalpānāṃ
śatapadmanayanacūḍā\var{
Ekadasamukham (bsu015_u.htm.txt) 21404903 (0.027):
hṛdayam / smarāmyahaṃ bhagavan gaṅgānadīvālukāsamānāṃ kalpānāṃ pareṇa / śatapadmanayanacūḍapratihataraṅgavelakiraṇarājasya nāma tathāgatasya /
\Dutt}pratihatasaṅgavelāma\var{
\Dutt}rājā\var{rājā\lem \cod; rājasya \em \Dutt} nāma tathāgata{ta}sya{ā}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540586 (0.045):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540314 (0.048):
trāṇam śaraṇam parāyaṇaṃ bhavāmi yat\var{yat\lem \Dutt; yaḥ \cod} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540530 (0.053):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540278 (0.057):
yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
ñ1.10 mayā tathāgatasyānti[ke] anuśrutenāyaṃ\var{anuśrutenāyaṃ\lem
Padmagupta (alias Parimala): Navasahasankacarita (padnscxu.htm.txt) 10098255 (0.042):
dhṝtam udakam etya pṝṣṭhatas+\var{pṝṣṭhataḥ\lem \em; pṝṣṭataḥ \ed}
Nilakantha Diksita: Kalividambana (nkalivxu.htm.txt) 5548711 (0.042):
giram+ skhalantīm+ mīlantīm+ & dṛṣṭim+ pādau visaṃsthulau / \var{visaṃsthulau\lem \em; visaṃsphuṭau \ed} |
Padmagupta (alias Parimala): Navasahasankacarita (padnscxu.htm.txt) 10097732 (0.052):
vyālupta-pakṣma-āvali-sauṣṭhavāni \var{sauṣṭhavāni\lem \em; sauṣṭavāni
\em\Ken; śrutam ayaṃ \Dutt} hṛdayam udgṛhītaṃ\var{udgṛhītaṃ\lem \cod;
udgṛhītaṃ ca \Dutt} / saha pratilaṃbhe[na] daśasu dikṣu sarvatathāgatā<ḥ>
SUKHAVATIVYUHA (sukhvylu.htm.txt) 16530694 (0.028):
imaṃ khalv ānandārthavasaṃ saṃpaśyantas, te tathāgatā / daśasu dikṣv aprameyāsaṃkhyeyāsu lokadhātusu tasyāmitābhasya
Gandavyuhasutra (bsu016_u.htm.txt) 28696476 (0.033):
jānāmi / apratiprasrabdhā ca me daśasu dikṣu sarvatathāgatapādamūleṣu
Ekadasamukham (bsu015_u.htm.txt) 21404925 (0.037):
mayā tathāgatasyāntike śrutamayaṃ hṛdayam udgṛhītaṃca / saha pratilaṃbhena / daśasu dikṣu sarvatathāgatāḥ (Em 37) sumukhībhūtā
Sukhavativyuha, Vistaramatrika (bsu033_u.htm.txt) 21412082 (0.041):
imaṃ khalvānanda arthavaśaṃ saṃpaśya tathāgatā daśasu dikṣu / aprameyāsaṃkhyeyāsu lokadhātuṣu tasyāmitābhasya tathāgatasya nāmagheyaṃ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15272945 (0.043):
upādāya. evam ekaikasyāṃ diśi yāvad daśasu dikṣu sarvalokadhātavas / tathāgataiḥ paripūrṇā (PSP_2 3:175) bhaveyuḥ, tadyathāpi nāma naḍavanaṃ vā
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6176502 (0.048):
daśasu dikṣv aprameyāsakhyeyeṣu lokadhātuṣu tāṃ tathāgatān arhataḥ
Bodhisattvapratimoksasutra (bsu011_u.htm.txt) 24249046 (0.052):
yad daśasu dikṣvanantāparyyantesu lokadhātuṣu tathāgatānāṃ tiṣṭhatāṃ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15260759 (0.054):
ārambaṇais te buddhā bhagavanto nimittīkṛtās tadā ye te daśasu dikṣu
Mahasannipataratnaketudharanisutra (Ratnaketuparivarta) (Parivartas 1-6, 10-11) (bsu024_u.htm.txt) 12477936 (0.055):
/ te 'hamapyetarhi ratnaketuṃ dhāraṇīṃ bhāṣiṣyāmi / anumodiṣyanti ca / daśasu dikṣu pratyutpannānaṃ tathāgatānāṃ bhāṣamāṇānāmahamimāṃ
Lalitavistara (bsu022_u.htm.txt) 9888446 (0.057):
aprameyāsaṃkhyeyā lokadhātavo 'vabhāsyante / daśasu dikṣu bodhisattvāśca / devāputrāścanandaśabdaṃ niścārayāmāsuḥ utpannaḥ sattvapaṇḍitaḥ / padmo
Saddharmapundarikasutra (bsu036_u.htm.txt) 6564601 (0.057):
'dhvanyabhūvan daśasu dikṣvaprameyeṣvasaṃkhyeyeṣu lokadhātuṣu tathāgatā
Mahasannipataratnaketudharanisutra, or Ratnaketuparivarta (=RKP) (ratnakeu.htm.txt) 5193809 (0.059):
anumoditāḥ / ye 'py etarhi daśasu dikṣu buddhā bhagavantaḥ tiṣhaṃti / dhṛyaṃti yāpayaṃti dharmaṃ deśayanti te sarve 'pi
Gandavyuhasutra (bsu016_u.htm.txt) 28679807 (0.059):
sahapratilābhāttasmāddaśasu dikṣu nānālokadhātusthitā
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15261624 (0.059):
samyagājñāsuvimukticittānāṃ sarvacetavaśiparamapāramitāprāptānāṃ, ye te / daśasu dikṣv aprameyeṣv asaṃkhyeyeṣu tathāgatā arhantaḥ samyaksaṃbuddhās
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1902759 (0.061):
darśayati / buddhabodhisatvabimbānyapi darśayati / daśasu dikṣu / sarvabuddhakṣetreṣu tathāgatāḥ saparṣanmaṇḍalāḥ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6610222 (0.061):
keciddaśasu dikṣu anantāparyantāsu lokadhātuṣu buddhā bhagavantastiṣṭhanti
Satasahasrika Prajnaparamita, II-2 (sspp2_2u.htm.txt) 22979930 (0.062):
te āyuṣmañ chāradvatīputra daśasu dikṣu lokadhātuṣu tathāgatārhantaḥ
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6974807 (0.063):
26826 bhgāṣante/ evaṃ samantād daśasu dikṣv asaṃkhyeyeṣv aprameyeṣu / 26901 {{lokadhātuṣu tathāgatā arhantaḥ samyaksaṃbuddhā bodhisattvānāṃ
Pancavimsatisahasrika Prajnaparamita (pspduttu.htm.txt) 796083 (0.063):
mahāsattvānāṃ prajñāpāramitāṃ bhgāṣante evaṃ samantād daśasu dikṣv / asaṃkhyeyeṣv aprameyeṣu lokadhātuṣu tathāgatā arhantaḥ samyaksaṃbuddhā
Saddharmapundarikasutra (bsu036_u.htm.txt) 6564709 (0.063):
ye 'pi te śāriputra anāgate 'dhvani bhaviṣyanti daśasu / dikṣvaprameyeṣvasaṃkhyeyeṣu lokadhātuṣu tathāgatā arhantaḥ samyaksaṃbuddhā
sumukhībhūtā anutpattikadharmakṣāntipratilabdhāḥ /
Ekadasamukham (bsu015_u.htm.txt) 21404932 (0.0):
daśasu dikṣu sarvatathāgatāḥ (Em 37) sumukhībhūtā / anutpattikadharmakṣāntipratilabdhāḥ / evaṃ bahukaro 'yaṃ hṛdayam
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6906805 (0.049):
sānut / 07208 pattikadharmakṣāntipratilabdhasya {bodhisattvasya} mahāsattvasya
Santideva: Siksasamuccaya (sanssr_pu.htm.txt) 26961432 (0.056):
bodhisatvānāṃ | annārambaṇā maitrī annutpattikadharmakṣāntipratilabdhānāṃ / bodhisatvānām iti || / punar buddhārambaṇā bodhisatvārambaṇā śrāvakapratyekabuddhārambaṇā
Lalitavistara (bsu022_u.htm.txt) 9830646 (0.057):
sarvabodhisattvasamādhivaśitāprāptaiḥ sarvabodhisattvavaśitāpratilabdhaiḥ / sarvabodhisattvakṣāntyavakīrṇaiḥ sarvabodhisattvabhūmiparipūrṇaiḥ /
Samghatasutra (bsu045_u.htm.txt) 7830234 (0.060):
sarveṣāmanyatīrthikacarakaparibrājakanigranthabrāhmaṇānāmanutpattikadharmakṣāntipraitlabdho / 'bhūvat sarve ca daśabhūmipratiṣṭhitā bodhisattvāḥ saṃvṛttāḥ sarve ca te
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6974831 (0.060):
anutpattikadharmakṣāntipratilambho / 26903 'bhūt/ teṣām api buddhānāṃ bhagavatāṃ samantād daśasu dikṣu
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4058745 (0.060):
sarvadharmā anutpattikā ityadhimuñcanti, na ca / tāvadanutpattikadharmakṣāntipratilabdhā bhavanti / sarvadharmāḥ śāntā
Vimalakirtinirdesa (bsu061_u.htm.txt) 23931081 (0.061):
vraṇayanti cānutpattikadharmakṣānti śīghranna labhante / evamāmantrayate"
madhyantavibhagatika.html 19082420 (0.064):
aṣṭamyāṃ hi bhūmau bodhisattvo'nutpattikadharmakṣāntipratilambhād / dharmadhātor abhyuccayā'bhāvatvam apacayā'bhāvatvaṃ caivaṃ
Astadasasahasrika Prajnaparamita, Parivartas 55 - 70 (first part) (adsp55-u.htm.txt) 23101195 (0.064):
śāntā ity adhimuktā na ca anutpattikeṣu dharmeṣu kṣāntiḥ pratilabdhā. / sarvadharmā riktakā iti tucchakā iti vaśikā ity asārakā ity adhimuktā na
ñ1.11 evaṃ bahukaro 'yaṃ mā\ill*hṛdayaṃ tasmāt tarhi śrāddhena kulaputreṇa
Ekadasamukham (bsu015_u.htm.txt) 21404940 (0.0):
daśasu dikṣu sarvatathāgatāḥ (Em 37) sumukhībhūtā / anutpattikadharmakṣāntipratilabdhāḥ / evaṃ bahukaro 'yaṃ hṛdayam
Mahasahasrapramardani (mspram_u.htm.txt) 24945099 (0.015):
mitrāmitramadhyagato 'pi satkṛto bhaviṣyati / te ca śrāddhena kulaputreṇa / vā kuladuhitrā vā śucinā bhavitavyam / śucikāyena
Bhaisajyaguruvaiduryaprabharajasutra (bsu012_u.htm.txt) 8360261 (0.026):
tathāgatasya saddharmakośaṃ dhārayataḥ | tasmāt tarhi mañjuśrīḥ śrāddhena / kulaputreṇa vā kuladuhitrā vā tatra buddhakṣetropapattaye praṇidhānaṃ
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6155358 (0.026):
bhaviṣyati. tasmāt tarhi kauśika śrāddhena kulaputreṇa vā kuladuhitrā vā
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4017606 (0.034):
punaraparaṃ bodhisattvayānikena kulaputreṇa vā kuladuhitrā vā evaṃ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15262870 (0.035):
subhūtir aha: iha mahāyānikena kulaputreṇa vā kuladuhitrā vā
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15262889 (0.035):
subhūtir āha: iha mahāyānikena kulaputreṇa vā kuladuhitrā vā
Fragments of Prajnaparamita texts (from 16 sources) (ppfrag_u.htm.txt) 18569651 (0.037):
8 /// .. .. .. thaivaiha kartavyaṃ | kathaṃ .. + + + + + + + + + + + + + + / 9 /// .. .. .. kulaputreṇa kuladuhitrā + + + + + + + + + + + + ///
Saddharmapundarikasutra (bsu036_u.htm.txt) 6611404 (0.039):
nakṣatrarājasaṃkusumitābhijña tena bodhisattvayānasaṃprasthitena / kulaputreṇa vā kuladuhitrā vā evaṃrūpaṃ sūtrāntadhārakaṃ bhikṣuṃ dṛṣṭvā
Astadasasahasrika Prajnaparamita, Parivartas 55 - 70 (first part) (adsp55-u.htm.txt) 23102449 (0.043):
kuśalamūlāny avaropitāni bhaviṣyanti. veditavyam ānanda tena kulaputreṇa / vā kuladuhitrā vā, na mayā śrāvakāṇām antike kusalamūlāny avaropitāni, na
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4003402 (0.044):
tasmāttarhi kauśika kulaputreṇa vā kuladuhitrā vā kṣipraṃ cānuttarāṃ
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4011427 (0.044):
prajñāpāramitāprativarṇikāyāṃ carati / tasmāttarhi kauśika kulaputreṇa vā / kuladuhitrā vā prajñāpāramitāyā artha upadeṣṭavyaḥ / prajñāpāramitāyā
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15246472 (0.044):
tasmāt tarhi kauśika kulaputreṇa vā kuladuhitrā vā kṣipraṃ ca sukhaṃ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15249215 (0.044):
tasmāt tarhi kauśika kulaputreṇa vā kuladuhitrā vā prajñāpāramitā
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15255555 (0.044):
ca. tasmāt tarhi kauśika kulaputreṇa vā kuladuhitrā vā tathāgatān arhataḥ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15258665 (0.044):
upadekṣyanti. tasmāt tarhi kauśika kulaputreṇa vā kuladuhitrā vā evaṃ
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6207513 (0.044):
vā na prajñāpāramitāprativarṇikām upadekṣyanti. tasmāt tarhi kauśika / kulaputreṇa vā kuladuhitrā vā evaṃ prajñāpāramitāyā artham upadeṣṭavyo
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15251433 (0.045):
hi kauśika kulaputreṇa vā kuladuhitrā vā evaṃ cittam utpādayitavyaṃ: ye te
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6169473 (0.045):
tatra kauśika tena kulaputreṇa vā kuladuhitrā vā evaṃ cittam
Bhaisajyaguruvaiduryaprabharajasutra (bsu012_u.htm.txt) 8361690 (0.045):
kadāpi pāpam akuśalaṃ karma kariṣyati | tasmāc chrāddhena kulaputreṇa vā / kuladuhitā vā tasya bhagavato bhaiṣajyaguruvaidūryaprabhasya tathāgatasya
vā kuladuhitrā vā satkṛtyāyaṃ hṛdayaṃ sādhayitavya{ṇa}m / ananyamanasā
Ekadasamukham (bsu015_u.htm.txt) 21404942 (0.0):
tasmāttarhi śrāddhena kulaputreṇa vā kuladuhitrā vā satkṛtyāyaṃ hṛdayaṃ
Bhaisajyaguruvaiduryaprabharajasutra (bsu012_u.htm.txt) 8360261 (0.031):
tathāgatasya saddharmakośaṃ dhārayataḥ | tasmāt tarhi mañjuśrīḥ śrāddhena / kulaputreṇa vā kuladuhitrā vā tatra buddhakṣetropapattaye praṇidhānaṃ
Sukhavativyuha, Samksiptamatrka (bsu032_u.htm.txt) 17499841 (0.033):
saṃpaśyamāna eva vadāmi - satkṛtya kulaputreṇa vā kuladuhitrā vā tatra
THE SMALLER SUKHAVATIVYUHA (sukhvysu.htm.txt) 4688123 (0.033):
evaṃ vadāmi satkṛtya kulaputreṇa vā kuladuhitrā vā tatra buddhakṣetre
Mahasahasrapramardani (mspram_u.htm.txt) 24945099 (0.033):
mitrāmitramadhyagato 'pi satkṛto bhaviṣyati / te ca śrāddhena kulaputreṇa / vā kuladuhitrā vā śucinā bhavitavyam / śucikāyena
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6155358 (0.041):
bhaviṣyati. tasmāt tarhi kauśika śrāddhena kulaputreṇa vā kuladuhitrā vā
Bhaisajyaguruvaiduryaprabharajasutra (bsu012_u.htm.txt) 8361691 (0.056):
kadāpi pāpam akuśalaṃ karma kariṣyati | tasmāc chrāddhena kulaputreṇa vā / kuladuhitā vā tasya bhagavato bhaiṣajyaguruvaidūryaprabhasya tathāgatasya
Astadasasahasrika Prajnaparamita, Parivartas 55 - 70 (first part) (adsp55-u.htm.txt) 23102449 (0.057):
kuśalamūlāny avaropitāni bhaviṣyanti. veditavyam ānanda tena kulaputreṇa / vā kuladuhitrā vā, na mayā śrāvakāṇām antike kusalamūlāny avaropitāni, na
Saddharmapundarikasutra (bsu036_u.htm.txt) 6611404 (0.058):
nakṣatrarājasaṃkusumitābhijña tena bodhisattvayānasaṃprasthitena / kulaputreṇa vā kuladuhitrā vā evaṃrūpaṃ sūtrāntadhārakaṃ bhikṣuṃ dṛṣṭvā
Saddharmapundarikasutra (bsu036_u.htm.txt) 6617649 (0.059):
bhagavan kulaputreṇa vā kuladuhitrā vā ayaṃ saddharmapuṇḍarīko
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15251433 (0.059):
hi kauśika kulaputreṇa vā kuladuhitrā vā evaṃ cittam utpādayitavyaṃ: ye te
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6169473 (0.059):
tatra kauśika tena kulaputreṇa vā kuladuhitrā vā evaṃ cittam
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4017606 (0.059):
punaraparaṃ bodhisattvayānikena kulaputreṇa vā kuladuhitrā vā evaṃ
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4004649 (0.060):
mānayatā pūjayatā arcayatā apacāyatā kulaputreṇa vā kuladuhitrā vā
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4042495 (0.062):
samyaksaṃbodhirabhisaṃboddhavyeti, naitadbuddhabhāṣitamiti / tena / kulaputreṇa vā kuladuhitrā vā evaṃ jñātavyamevaṃ samanvāhartavyamevaṃ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15271412 (0.062):
samuttejayitavyaḥ saṃpraharṣayitavyaḥ. evaṃ hi kulaputreṇa vā kuladuhitrā
Suvikrantavikramipariprccha (bsu030_u.htm.txt) 12560435 (0.062):
kulaputreṇa vā kuladuhitrā vā bodhisattvayānīyena vā śrāvakayānīyena vā
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15262870 (0.064):
subhūtir aha: iha mahāyānikena kulaputreṇa vā kuladuhitrā vā
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15262889 (0.064):
subhūtir āha: iha mahāyānikena kulaputreṇa vā kuladuhitrā vā
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6170058 (0.064):
pracārayitavyā, tena kulaputreṇa vā kuladuhitrā vā asyāḥ prajñāpāramitāyāḥ
nityaṃ sādhayitavyaṃ / / ñ1.12 kālyam\var{kālyam\lem \cod; kalyam \Dutt} utthāya aṣṭotaraṃ
vāraśataṃ pravartayitavyam / / ñ1.13 dṛṣṭadharmikā guṇā daśa parigrahīyāḥ\var{parigrahīyāḥ\lem \cod;
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540371 (0.041):
gacchanti\var{gacchanti\lem \Dutt; gakṣanti \cod} .
Ekadasamukham (bsu015_u.htm.txt) 21404957 (0.042):
aṣṭottaravāraśataṃ pravartayitavyam / ddaṣṭadharmikā guṇā daśa
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540351 (0.045):
evaṃ mahārthiko\var{mahārthiko\lem \cod; mahārdhiko \Dutt} 'yaṃ mama
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540586 (0.052):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
Nilakantha Diksita: Kalividambana (nkalivxu.htm.txt) 5548710 (0.055):
giram+ skhalantīm+ mīlantīm+ & dṛṣṭim+ pādau visaṃsthulau / \var{visaṃsthulau\lem \em; visaṃsphuṭau \ed} |
Padmagupta (alias Parimala): Navasahasankacarita (padnscxu.htm.txt) 10098254 (0.055):
dhṝtam udakam etya pṝṣṭhatas+\var{pṝṣṭhataḥ\lem \em; pṝṣṭataḥ \ed}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540315 (0.056):
trāṇam śaraṇam parāyaṇaṃ bhavāmi yat\var{yat\lem \Dutt; yaḥ \cod} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540278 (0.056):
yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540530 (0.063):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
parigrahītavyāḥ\Dutt \em} / / ñ1.14 katame daśa{ḥ} ?
ñ1.15 [1] yad uta nirvyādhir bhaviṣyati / / ñ1.16 [2] sarvata parigṛhītaś ca bhaviṣyati /
Gandavyuhasutra (bsu016_u.htm.txt) 28672794 (0.0):
katame daśa? yaduta āsaritaṃ vā niḥsaritaṃ vā, śītaṃ voṣṇaṃ vā, kṣudhā vā
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6952976 (0.017):
bhūmau vartamānasya viṃśatiḥ dharmā na / 21609 bhavanti/ katame viṃśatiḥ/ yad uta ātmagrāho 'sya na bhavati
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6953138 (0.017):
bhūmau vartamānena catvāro dharmāḥ / 21702 paripūrayitavyāḥ/ katame catvāraḥ/ yad uta sarvasattvacittānupraveśo
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6953235 (0.025):
bhūmau vartamānena dvādaśa dharmāḥ paripūrayi / 21712 tavyāḥ/ katame dvādaśa/ yad uta anantapraṇidhānaparigrahaḥ/ sa yathā
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6951842 (0.027):
utāṣṭādaśāveṇikā buddhadharmāḥ/ katame aṣṭādaśa/ yad uta
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6951460 (0.030):
21006 punar {aparam subhūte bodhisattvasya mahāsattvasya mahāyānaṃ}/ yad / uta daśānusmṛtayaḥ/ katamā daśa/ yad uta buddhānusmṛtir dharmānu{smṛtir}
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6952913 (0.032):
vartamānena ṣaḍ dharmā paripūrayitavyāḥ/ / 21602 katame ṣaṭ/ yad uta ṣaṭ pāramitāḥ paripūrayitavyāḥ/ apare ṣaḍ
Ekadasamukham (bsu015_u.htm.txt) 21404964 (0.034):
parigrahītavyāḥ / katame daśa / yaduta nirvyādhirbhaviṣyati /
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6953186 (0.036):
vartamānena catvāro dharmāḥ paripūra / 21707 yitavyāḥ/ katame catvāraḥ/ yad uta indriyaparāparajñānaṃ
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6953050 (0.037):
21615 viṃśatir eva dharmāḥ saptamyāṃ bhūmau sthitena paripūrayitavyāḥ/ / katame viṃśatiḥ/ / 21616 yad uta śūnyatāparipūritā nimittasākṣatkriyā apraṇihitajñānaṃ
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6952856 (0.049):
bhūmau vartamānena daśa dharmā parivarja / 21520 yitavyāḥ/ katame daśa/ yad uta gṛhiprabrajitasaṃstavaḥ
Patanjali: Vyakaranamahabhasya (Mahabhasya) (pmbhasuu.htm.txt) 5347224 (0.051):
samarthānām bhavati . tatra asāmārthyān na bhaviṣyati . atha cvyante
Visvanatha (kaviraja): Sahityadarpana, with the author's autocommentary Vasudhakara, (visah_cu.htm.txt) 9115543 (0.052):
vaidehī tu anīdṛśī / / kathaṃ bhaviṣyati, kiprakārā bhaviṣyatītyarthaḥ /
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6950889 (0.056):
yad uta pañcendriyāṇi/ katamāni / 20804 pañca/ śraddhendriyaṃ vīryendriyaṃ smṛtīndriyaṃ samādhīndriyaṃ
Patanjali: Vyakaranamahabhasya (Mahabhasya) (pmbhassu.htm.txt) 342421 (0.056):
khalu etat adhikārthe ārambhe sati ṇyadhikasya bhaviṣyati na punaḥ / sanadhikasya vā syāt yaṅadhikasya vā iti .
Patanjali: Vyakaranamahabhasya (Mahabhasya) (pmbhasuu.htm.txt) 5461475 (0.056):
ṇyadhikasya bhaviṣyati na punaḥ sanadhikasya vā syāt yaṅadhikasya vā iti .
Divyavadana (divyav_u.htm.txt) 21538687 (0.056):
058.027. api tu bhavanto 'ṣṭādaśānuśaṃsā buddhacārikāyām/ / 058.028. katame 'ṣṭādaśa ? nāgnibhyaṃ nodakabhyaṃ na siṃhabhyaṃ na
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9087620 (0.057):
svastyayanaṃ ca / adya mamāyaṃ sarvaviṣaya ārakṣito bhaviṣyati / / paripālitaścānutpīḍitaścānutkaṇṭhikaśca / sarvaparacakrānavamarditaścānupasargaścānupāyāsaśca bhaviṣyati //
A Digital edition of the Abhisamacarika-Dharma (abhisdhu.htm.txt) 14493863 (0.057):
pāñcadaśiko vā sandhipoṣadho vā kiṃ rā(2b5)tripoṣadho bhaviṣyati / divāpoṣadho purebhakti bhaviṣyati / paścādbhaktaṃ / kahiṃ bhaviṣyati /
Sardulakarnavadana (divav33u.htm.txt) 6630442 (0.058):
p.53.2/.amīṣāṃ bhoḥ puṣkarasārinn aṣṭāviṃśatīnāṃ nakṣatrāṇāṃ sapta balāni/ / katamāni sapta/ yad uta trīṇi pūrvāṇi viśākhānurādhā punarvashḥ svātiś ca/
ñ1.17 [3] dhanadhānyahiraṇyasaṃbharaṇam\var{
Ekadasamukham (bsu015_u.htm.txt) 21404971 (0.054):
sarvatathāgataiḥ parigṛhītaśca bhaviṣyati / dhanadhānyahiraṇyābharaṇamasya
Sarvatathagatatattvasamgraha (sarvttsu.htm.txt) 1882936 (0.062):
niryatayāmāsa / oṃ nāgavajrānaya / sarvadhanadhānyahiraṇyasuvarṇamaṇimuktālaṅkārādīni sarvopakaraṇāni
Gandavyuhasutra (bsu016_u.htm.txt) 28599978 (0.063):
śreṣṭhidārakasya gṛhe sarvakośakoṣṭhāgāreṣu / dhanadhānyahiraṇyasuvarṇavividharatnavarṣāṇyabhipravarṣitāni / tasya
ābharaṇaṃ \em \Dutt} asya akṣayaṃ bhaviṣyati / / ñ1.18 [4] sarvaśatravo vaśyā avamarditā bhaviṣyanti /
Ekadasamukham (bsu015_u.htm.txt) 21404980 (0.0):
akṣayaṃ bhaviṣyati / sarvaśatravo vaśyā avamarditā bhaviṣyanti /
Bower Manuscript. (bowermsu.htm.txt) 18507002 (0.051):
6 nihatā śatravas sarve yad īpsase kam* // navikkī 333 na te śoko na
Gunakarandavyuhasutra (bsu062_u.htm.txt) 24384796 (0.055):
mārite krodhacitte tu naśyante sarvaśatravaḥ // / vikalpedhanadiptena jantuḥ krodhāgninā kila /
ñ1.19 [5] rājasabhāyāṃ\var{
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9091573 (0.035):
bhaviṣyanti / gandhatarāṇi snigdhatarāṇyāsvadanīyāni darśanīyatarāṇi / mahottarāṇi ca bhaviṣyanti / te ca sattvāstāni pānabhojanāni
Ratnakarasanti: Saratama (bsa051_u.htm.txt) 7878806 (0.040):
dharmāntarāyikaḥ / tattayā tabhdāvena na sambhaviṣyanti na bhaviṣyanti /
Pancavimsatisahasrika Prajnaparamita, IV (psp_4u.htm.txt) 1623949 (0.041):
dharmaśravaṇikāś ca nāraṇyakā bhaviṣyanti na paiṇḍapātikā na pāṃśukūlikā / na khalupaścādbhaktikā na ekāsanikā na prasthapiṇḍikā na śmāśānikā
Santideva: Siksasamuccaya (sanss12u.htm.txt) 19114872 (0.043):
bhaviṣyati | / evam api te mahārāja gṛheṣûpalepanôpalipteṣu susthāpitârgaleṣu
Ganapatihrdaya-Dharani (ganphrdu.htm.txt) 1714860 (0.043):
dinedine kalpam utthāya sarvasaptavārānucārayitavyaṃ mahāsaubhāge / bhaviṣyati / (Gph_12) rājakulagamanakāle mahāprāsādo bhaviṣyanti /
Narayaniya (Mahabharata 12.321-339) (naray_bu.htm.txt) 15771683 (0.044):
<12326.80/1> tayor ye tv anvaye jātā !bhaviṣyanti vanau1kasaḥ ! / <12326.80/101> [X K1.2.4.6.7 Bo.6-9 Da3..a4 Dn1.ṇ4 Ds D2-5.7-9 T G1-3.6
Vimalakirtinirdesa (vimkn_u.htm.txt) 9779959 (0.045):
imaṃ dharmaparyāyaṃ svādhyāsyante / dharmasaṃrakṣakās te bhaviṣyanti, ya
Ahoratravratakatha (Prose version) (ahovk2_u.htm.txt) 9080576 (0.050):
mahārāja pratyārohayanti te rājāno bhavanti cakravartāś
ālaṃbitavyaṃ\var{ālaṃbitavyaṃ\lem \cod; ālapitavyaṃ \Dutt} maṃsyati /
ñ1.20 [6] na viṣaṃ na garam na jvaraṃ na śastram kāye kramiṣyati /
Ekadasamukham (bsu015_u.htm.txt) 21404994 (0.0):
rājasabhāyāṃ prathamamālapitavyaṃ maṃsyati / na viṣaṃ na garaṃ na jvaraṃ
Divyavadana (divyav_u.htm.txt) 21543174 (0.043):
071.007. tasyāṃ guhāyāṃ prabhāsvarā nāmauṣadhī panñcaguṇopetā/ / 071.007. tayā gṛhītayā nāsya kāye śastraṃ kramiṣyati, amanuṣyāścāvatāraṃ
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19050721 (0.062):
kālaṃ kariṣyati, na cāsya kāye viṣaṃ kramiṣyati, na śastraṃ kramiṣyati,
ñ1.21 [7] nodakena kālaṃ kariṣyati / / ñ1.22 [8] nāgninā kālaṃ kariṣyati /
Mahasitavati vidyarajni (msitvatu.htm.txt) 4477794 (0.0):
nāgninā na viṣodakena kālaṃ kariṣyati / vidyāmantraprayogānāṃ ca sarveṣāṃ
Ekadasamukham (bsu015_u.htm.txt) 21405002 (0.033):
na śastraṃ kāye kramiṣyati / nodakena kālaṃ kariṣyati / nāgninā kālaṃ
Satasahasrika Prajnaparamita II-4 (sspp2_4u.htm.txt) 6162826 (0.033):
ca manasikariṣyati, sa na viṣeṇa kālaṃ kariṣyati, na śastreṇa kālaṃ / kariṣyati, nāgninā kālaṃ kariṣyati, nodakena kālaṃ kariṣyati, yāvan
Nagaropamasutra (nagsu_tu.htm.txt) 15617404 (0.034):
ahinā na daṃkṣyati viṣaṃ kāye na tariṣyati śastraṃ na kramiṣyati nodakena / kālaṃ kariṣyati agninā na daṅkṣyati rājāno 'pi na prasahīṣyaṃti corā na
Nagaropamasutra (nagsu_tu.htm.txt) 15618259 (0.034):
manasikariṣyati sa ahinā na daṃkṣyati viṣaṃ kāye na tariṣyati ─ śastraṃ na / kramiṣyati ─ nodakena kālaṃ kariṣyati agninā na dhakṣyati rājāno 'pi na
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4005625 (0.038):
kālaṃ kariṣyanti, nāgninā kālaṃ kariṣyati, nodakena kālaṃ kariṣyanti, na
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19050716 (0.054):
bhaviṣyati, na caurabhayaṃ bhaviṣyati, nāgnibhayaṃ bhaviṣyati, nodakena / kālaṃ kariṣyati, na cāsya kāye viṣaṃ kramiṣyati, na śastraṃ kramiṣyati,
Divyavadana (divyav_u.htm.txt) 21543174 (0.059):
071.007. tasyāṃ guhāyāṃ prabhāsvarā nāmauṣadhī panñcaguṇopetā/ / 071.007. tayā gṛhītayā nāsya kāye śastraṃ kramiṣyati, amanuṣyāścāvatāraṃ
ñ1.23 [9] nākālamṛtyunā kālaṃ\var{kālaṃ\lem \cod; kālaṃ ca \Dutt}
Ekadasamukham (bsu015_u.htm.txt) 21405006 (1.192):
na śastraṃ kāye kramiṣyati / nodakena kālaṃ kariṣyati / nāgninā kālaṃ / kariṣyati / nākālamṛtyunā kālaṃca kariṣyati / apare cattvāro guṇānuśaṃsā
Sarvatathagatosnisasitatpatra-nama-aparitamahapratyangiravidyarajni (Sitatapatra) (bsu004_u.htm.txt) 14313244 (0.035):
kramiṣyati / nagaraṃ kramiṣyati, yogaṃ kramiṣyati, nākālamṛtyunā kālaṃ / kariṣyati / sarvagrahāṇāṃ sarvavighnavināyakānāṃ ca priyo bhaviṣyati /
Mahasitavati vidyarajni (msitvatu.htm.txt) 4477793 (0.045):
nāgninā na viṣodakena kālaṃ kariṣyati / vidyāmantraprayogānāṃ ca sarveṣāṃ
Grahamatrkanamadharani (grahmdhu.htm.txt) 26664871 (0.056):
sattvajātīyā yeṣāṃ karṇapuṭe śabdaṃ nipatiṣyanti na teṣām akālamṛtyunā / kālaṃ kariṣyanti / yaś ca khalu punar vajrapāṇe grahān maṇḍalamadhye
kariṣyati / %NB number 10 seems to be missing, or a different counting is
Harivamsa, Appendix I. (hv_appau.htm.txt) 597841 (0.026):
ye devagandharvamaharṣisattvāḥ | HV_App.I,29D.493 | / [k: a line seems to be missing in all Mss.; while D6 (marg.) ins.
Mrgendragama (=Mrgendratantra) (mrgt3cpu.htm.txt) 977788 (0.026):
%% \Kir\ 51:49cd; Brunner points out that the line is / %% also to be found as Uttarakāmika 37:61cd.
Timirodghāṭana (plus short Nirvāṇakārikā at the end) (timudghu.htm.txt) 5513720 (0.027):
%``taught in all sciences''? or ``said to be the essence
A Digital edition of the Abhisamacarika-Dharma (abhisdhu.htm.txt) 14493014 (0.029):
(1) The letters between ( ) indicate that they should be supplied. / (2) The letters which seem to be wrongly written are underlined.
Amaru: Amarusataka (amaru_u.htm.txt) 24186838 (0.030):
edition. There seems to be a great deal of variation in the order and
Amaru: Amarusataka (amaru_u.htm.txt) 24190517 (0.030):
line of each verse is the number of the verse in the Motilal edition. / There seems to be a great deal of variation in the order and numbering
Buddhasvamin: Brhatkathaslokasamgraha (brkas_pu.htm.txt) 5776258 (0.030):
[The final verse seems to be missing] ||18.703|
Timirodghāṭana (plus short Nirvāṇakārikā at the end) (timudghu.htm.txt) 5513536 (0.030):
guropadeśa- or is it meant to be guroḥ+upadeśa-
Vaikhanasamantraprasna, Prasnas 5 - 8 (vaimp__u.htm.txt) 12143575 (0.033):
indrā jam seems to be what is intended.
Buddhasvamin: Brhatkathaslokasamgraha (brkas_pu.htm.txt) 5743837 (0.033):
corrected. In a few cases I also adopted a different reading, when / it seemed to make more sense. It is also an uncorrected version.
Rupa Gosvamin: Haribhaktirasamrtasindhu (ruphbr_u.htm.txt) 13144855 (0.034):
yathā haṃsadūte (50) {*This actually appears to be a mix of verses 50 51.
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556533 (0.034):
placed on dead keys and need to be typed before the character is
Kautilya: Arthasastra (kautil_u.htm.txt) 5570668 (0.035):
(Examination of the precious articles to be received into the treasury)
Simhabhupala: Rasarnavasudhakara (simhrs_u.htm.txt) 1738737 (0.035):
tu ceṣṭāḥ syuḥ santāpaś cāṅga sādanam | This does not appear to be / serious. (See karika 54)
Bharata: Natyasastra (bharnatu.htm.txt) 27956909 (0.035):
(see the cluster ṅghā. ā nev ligature may be added to represent this
Jiva Gosvami: Satsamdarbha, part 4: Krsnasamdarbha (ss4_krsu.htm.txt) 14396592 (0.035):
edition appears to be earlier than the Vrindavan edition published by
ASVAGHOSA: BUDDHACARITA (asvbc_1u.htm.txt) 1033417 (0.035):
verse to which it refers. (While transliterating the full / reference needs to be typed only for the first verse of each
Kasyapaparivartasutra (kasyparu.htm.txt) 9785886 (0.037):
pages omitted; and the next folio onwards is mistakenly paginated.
A Digital edition of the Abhisamacarika-Dharma (abhisdhu.htm.txt) 14493081 (0.037):
(7) Symbols which seem to be SiddhaM, etc., are substituted by * "."
Gheranda-Samhita (ghers_au.htm.txt) 10187313 (0.037):
user of the electronic version is requested to consult the printed version
required / ñ1.24 apare catvāro guṇānuśaṃsā udgrahīṣyati /
Kuḍaka's Samanvayadiś (SD) (samanv_u.htm.txt) 13214769 (0.043):
primarily for crushed bananas or plantain fruits mixed with milk and
Maitrayani-Samhita (maitrs_pu.htm.txt) 3505424 (0.047):
ādadāmahe : FN ādadāmahai is also possible / ye agnayo divo ye pṛthivyāḥ samāgachantīṣam ūrjaṃ vasānāḥ /
Vaikhaanasa Dharmasuutra \VKHDHS)1-3 (vaikhd_u.htm.txt) 28548361 (0.055):
pala.aṇḍuka.vakala.śuna.gṛñcana.viḍjam anuktaṃ\reading uncertain Cal
Ekadasamukham (bsu015_u.htm.txt) 21405012 (0.058):
kariṣyati / nākālamṛtyunā kālaṃca kariṣyati / apare cattvāro guṇānuśaṃsā
ñ1.25 [1] maraṇakāle tathā[gatada]rśanaṃ bhaviṣyati /
Ekadasamukham (bsu015_u.htm.txt) 21405013 (0.058):
kariṣyati / nākālamṛtyunā kālaṃca kariṣyati / apare cattvāro guṇānuśaṃsā / udgrahīṣyati / maraṇakāle tathāgatadarśanaṃ bhaviṣyati / na
ñ1.26 [2] na cāpāyeṣūpapatsyate / / ñ1.27 [3] na [viṣamā]parihāreṇa kālaṃ kariṣyati /
Ekadasamukham (bsu015_u.htm.txt) 21405025 (0.043):
udgrahīṣyati / maraṇakāle tathāgatadarśanaṃ bhaviṣyati / na / cāpāyepūpapatsyate / naviṣamāparihāreṇa kālaṃ kariṣyati / itścyutaḥ
Pancavimsatisahasrika Prajnaparamita, II-III (psp_2-3u.htm.txt) 15249137 (0.050):
veṇukārakuleṣūpapatsyate na puṣkasakuleṣūpapatsyate na / mauṣṭikakuleṣūpapatsyate na caṇḍālaurabhrikaśākunikakuleṣūpapatsyate na
Manjusrimulakalpa (bsu041_u.htm.txt) 11447772 (0.053):
devebhyaśca cyavitvā tu manuṣyebhyopapatsyate / / manuṣyebhyopapannastu pravrajecchāsane mama // Mmk_53.444 //
Bodhisattvabhumi (bsa034_u.htm.txt) 24876054 (0.059):
atītānāgatapratyutpanneṣvadhvasu śubhāsu bhadrāsu kalyāṇāsu / upapattiṣūpapannā upapatsyante upapadyante ca sarve te āsveva pañcasu /
ñ1.28 [4] itaś cutaḥ sukhāvatyāṃ lokadhātāv upapatsyate
Ekadasamukham (bsu015_u.htm.txt) 21405031 (0.053):
cāpāyepūpapatsyate / naviṣamāparihāreṇa kālaṃ kariṣyati / itścyutaḥ / sukhāvatyāṃ lokadhātāvupapatsyate / / smarāmyahaṃ bhagavanniti daśānāṃ gaṅgānadīvālukāsamānāṃ kalpānāṃ tataḥ
smarāmy ahaṃ bhagavann it daśānāṃ gaṅgānadībāl[u]kāsamānāṃ kalpānāṃ tataḥ
Ekadasamukham (bsu015_u.htm.txt) 21405041 (0.0):
cāpāyepūpapatsyate / naviṣamāparihāreṇa kālaṃ kariṣyati / itścyutaḥ / sukhāvatyāṃ lokadhātāvupapatsyate / / smarāmyahaṃ bhagavanniti daśānāṃ gaṅgānadīvālukāsamānāṃ kalpānāṃ tataḥ
Ekadasamukham (bsu015_u.htm.txt) 21404901 (0.021):
hṛdayam / smarāmyahaṃ bhagavan gaṅgānadīvālukāsamānāṃ kalpānāṃ pareṇa
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18539973 (0.022):
ñ1.9 smarāmy ahaṃ bhagavaṃ gaṅgānadībālukāsamānāṃ kalpānāṃ pareṇa
Gandavyuhasutra (bsu016_u.htm.txt) 28641795 (0.053):
sumeruparamāṇurajaḥsamānāṃ kalpānāṃ pareṇa paratareṇa candradhvajāyāṃ
Karunapundarikasutra (bsu018_u.htm.txt) 7677510 (0.055):
/ (KpSū 372) evaṃ ca me āśā paripūrṇā gaṅgānadīvālikāsamānāṃ / mahākalpānāmantareṇa sārthavāho 'bhūvan, gaṅgānadīvālikāsameṣu śūnyeṣu
pareṇa paratareṇa mandāravagandho nāma tathāgato 'bhūt{a} /
Ekadasamukham (bsu015_u.htm.txt) 21405046 (0.0):
smarāmyahaṃ bhagavanniti daśānāṃ gaṅgānadīvālukāsamānāṃ kalpānāṃ tataḥ / pareṇa paratareṇa mandāravagandho nāma tathāgato 'bhūt / tatra mayā
SUKHAVATIVYUHA (sukhvylu.htm.txt) 16524773 (0.022):
'bhūt. tasya pareṇa parataraṃ candanagandho nāma tathāgato / 'bhūt. tasya pareṇa parataraṃ sumerukalpo nāma tathāgato
Gandavyuhasutra (bsu016_u.htm.txt) 28641795 (0.024):
sumeruparamāṇurajaḥsamānāṃ kalpānāṃ pareṇa paratareṇa candradhvajāyāṃ
Gandavyuhasutra (bsu016_u.htm.txt) 28612713 (0.027):
saṃdhāritam / tasya pareṇa keturnāma tathāgato 'bhūt / sa mayā ārāgitaḥ / / tasya pareṇa meruśrīrnāma tathāgato 'bhūt / tasya pareṇa padmagarbho nāma
Gandavyuhasutra (bsu016_u.htm.txt) 28679549 (0.028):
buddhakṣetrakoṭīparamāṇurajaḥsamānāṃ kalpānāṃ pareṇa / parataramīśvaraguṇāparājitadhvajo nāma tathāgato 'rhan samyaksaṃbuddho
Gandavyuhasutra (bsu016_u.htm.txt) 28612736 (0.037):
samantacakṣurnām tathāgataḥ / tasya pareṇa brahmaśuddho nāma tathāgataḥ / / tasya pareṇa vajranābhirnāma tathāgataḥ / tasya pareṇa varuṇadevo nāma
Gandavyuhasutra (bsu016_u.htm.txt) 28665605 (0.044):
bhūtapūrvaṃ kulaputra atīte 'dhvani lokadhātusamudraparamāṇurajaḥsamānāṃ / kalpānāṃ pareṇa parataraṃ maṇikanakaparvataśikharavairocano nāma
Saddharmapundarikasutra (bsu036_u.htm.txt) 6585333 (0.052):
bhikṣurmahāśrāvako dvāṣaṣṭīnāṃ buddhakoṭīnayutaśatasahasrāṇāṃ pareṇa / parataraṃ samantaprabhāso nāma tathāgato 'rhan samyaksaṃbuddho loke
Saddharmapundarikasutra (bsu036_u.htm.txt) 6578373 (0.055):
(Vaidya 101) | tataśca bhūyaḥ pareṇa paratareṇa punarviśatīnāṃ
Gandavyuhasutra (bsu016_u.htm.txt) 28683427 (0.060):
bhūtapūrvaṃ kulaputra atīte 'dhvani buddhakṣetraśataparamāṇurajaḥsamānāṃ / kalpānāṃ pareṇa abhayaṃkarā nāma lokadhāturabhūt / tasyāṃ khalu lokadhātau
tatra mayā gṛhaparibhūtenāyam udgṛhīta / / catvāriṃśat kalpasahasrāṇi saṃsārāḥ paścānmukhīkṛtāḥ\var{
Ekadasamukham (bsu015_u.htm.txt) 21405054 (0.0):
pareṇa paratareṇa mandāravagandho nāma tathāgato 'bhūt / tatra mayā / gṛhaparibhūtenāyamudgṛhītam / cattvāriṃśat kalpasahastrāṇi saṃsārāḥ
Ekadasamukham (bsu015_u.htm.txt) 21405150 (0.044):
caturdaśīpaṃcadaśī māmuddiśya upavasati / cattvāriṃśat kalpasahastrāṇi / saṃsārān paścānmukhīkarisyanti / tena nāmadheyamapi grahaṇena bhagavan
\em\Dutt;
eṣa ca mayā hṛdayaṃ pravartitvā sarvabuddhānāṃ\var{sarvabuddhānāṃ\conj
\Nagashima; sarvasmin \Dutt} karuṇāyanajñānagarbhabodhisattvavimokṣaṃ
Ekadasamukham (bsu015_u.htm.txt) 21405064 (0.049):
paścānmukhīkṛtāḥ / eṣa ca mayā hṛdayaṃ pravartitvā sarvasmin / karuṇāyanajñānagarbhabodhisattvavimokṣaṃ (Em 38) pratilabdham / ye
pra[tila]bdham / \marginpar{\Dutt p.38}
yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540315 (0.022):
trāṇam śaraṇam parāyaṇaṃ bhavāmi yat\var{yat\lem \Dutt; yaḥ \cod} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540531 (0.025):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540586 (0.030):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540087 (0.056):
ñ1.13 dṛṣṭadharmikā guṇā daśa parigrahīyāḥ\var{parigrahīyāḥ\lem \cod; / parigrahītavyāḥ\Dutt \em} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540371 (0.056):
gacchanti\var{gacchanti\lem \Dutt; gakṣanti \cod} .
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18539999 (0.057):
\Dutt}rājā\var{rājā\lem \cod; rājasya \em \Dutt} nāma tathāgata{ta}sya{ā}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540691 (0.063):
mili ciṭi\var{ciṭi\lem \cod; viṭi \Dutt} svāhā / / evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] //
vadhyaprāptā\var{ye\rarr badhyaprāptā repeated \dittography \cod} ye
udakāgnivividhaduḥkhābhyāhatā<ḥ> tad anenāhaṃ sarvasattvānāṃ layanaṃ
Ekadasamukham (bsu015_u.htm.txt) 21405086 (0.0):
bandhanabaddhā ye badhyaprāptā ye udakāgnivividhaduḥkhābhyāhatāḥ
Astadasasahasrika Prajnaparamita, Parivartas 70 (contd.) - 82 (adsp70-u.htm.txt) 15031638 (0.025):
kilādhyīṣṭa: sarvasattvānāṃ trāṇaṃ bhava layanaṃ śaraṇaṃ parāyaṇam iti.
Pancavimsatisahasrika Prajnaparamita, VI-VIII (psp_6-8u.htm.txt) 9802184 (0.062):
sadevamānuṣāsurasya ca lokasya kenāyam adhīṣṭaḥ sarvasattvānām ahaṃ trāṇaṃ / bhaviṣyāmi parāyaṇaṃ layanaṃ śaraṇam iti.
trāṇam śaraṇam parāyaṇaṃ bhavāmi yat\var{yat\lem \Dutt; yaḥ \cod} /
Ekadasamukham (bsu015_u.htm.txt) 21405088 (0.0):
tadanenāhaṃ sarvasattvānāṃ layanaṃ trāṇaṃ śaraṇaṃ parāyaṇaṃ bhavāmi / yat
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540532 (0.004):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
Astadasasahasrika Prajnaparamita, Parivartas 70 (contd.) - 82 (adsp70-u.htm.txt) 15031639 (0.016):
kilādhyīṣṭa: sarvasattvānāṃ trāṇaṃ bhava layanaṃ śaraṇaṃ parāyaṇam iti.
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540586 (0.022):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540278 (0.022):
pra[tila]bdham / \marginpar{\Dutt p.38} / yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
Pancavimsatisahasrika Prajnaparamita, VI-VIII (psp_6-8u.htm.txt) 9802186 (0.029):
sadevamānuṣāsurasya ca lokasya kenāyam adhīṣṭaḥ sarvasattvānām ahaṃ trāṇaṃ / bhaviṣyāmi parāyaṇaṃ layanaṃ śaraṇam iti.
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4002679 (0.047):
mānanīyaḥ pūjanīyo 'rcanīyo 'pacāyanīyaḥ satkaraṇīyo gurukaraṇīyaḥ, trāṇaṃ / śaraṇaṃ layanaṃ parāyaṇaṃ kṛto bhaviṣyati tatropagatānāṃ sattvānām / imam
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18539999 (0.048):
\Dutt}rājā\var{rājā\lem \cod; rājasya \em \Dutt} nāma tathāgata{ta}sya{ā}
Santideva: Siksasamuccaya (sanssr_au.htm.txt) 3765462 (0.049):
dharmo hi mahā rāja tasmin samaye trāṇaṃ layanaṃ śaraṇaṃ parāyaṇaṃ bhavati
Santideva: Siksasamuccaya (sanssr_pu.htm.txt) 26960581 (0.049):
mahārāja tasmin samaye trāṇaṃ layanaṃ śaraṇaṃ parāyaṇaṃ bhavati | tad
Santideva: Siksasamuccaya (sanss12u.htm.txt) 19114702 (0.053):
dharmo hi mahārāja tasmin samaye trāṇaṃ layanaṃ śaraṇaṃ parāyaṇaṃ bhavati
Manjusrimulakalpa (bsu041_u.htm.txt) 11332287 (0.056):
sa etarhi tiṣṭhati dhriyate yāpayati dharmaṃ ca do + + + + + + + + + + + + / + + + + + + + + trāṇaṃ layanaṃ śaraṇaṃ parāyaṇaṃ
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540087 (0.056):
ñ1.13 dṛṣṭadharmikā guṇā daśa parigrahīyāḥ\var{parigrahīyāḥ\lem \cod; / parigrahītavyāḥ\Dutt \em} /
Astadasasahasrika Prajnaparamita, Parivartas 55 - 70 (first part) (adsp55-u.htm.txt) 23094303 (0.057):
śāstāro mātāpitarau layanaṃ trāṇaṃ dvīpaṃ śaraṇaṃ parāyaṇaṃ yaduteṣā eva
Karandavyuha (bsu019_u.htm.txt) 7101561 (0.060):
sattvānāṃ trāṇaṃ bhava / aśaraṇānāṃ sattvānāṃ śaraṇaṃ parāyaṇaṃ
sarvaduṣṭayakṣarākṣasānām anayā hṛdayeṇā\var{anayā hṛdayeṇā\lem
Ekadasamukham (bsu015_u.htm.txt) 21405092 (0.061):
tadanenāhaṃ sarvasattvānāṃ layanaṃ trāṇaṃ śaraṇaṃ parāyaṇaṃ bhavāmi / yat / sarvaduṣṭayakṣarākṣasānāmanena hṛdayena karṣitvā maitracittān dayācittān
\cod\hybrid; anena hṛdayena \Dutt} karṣitvā maitracittā[n]
Ekadasamukham (bsu015_u.htm.txt) 21405098 (0.054):
sarvaduṣṭayakṣarākṣasānāmanena hṛdayena karṣitvā maitracittān dayācittān / kṛtvānuttarāyāṃ samyaksaṃbodhau pratiṣṭhāpayāmi / evaṃ mahardhiko 'yaṃ
dayācittān\var{dayācittān\lem \Dutt; dayācittādayācittān \cod}
Ekadasamukham (bsu015_u.htm.txt) 21405098 (0.053):
sarvaduṣṭayakṣarākṣasānāmanena hṛdayena karṣitvā maitracittān dayācittān
kṛtvānuttarāyāṃ samyaksaṃbodhau pratiṣṭhāpayāmi / / evaṃ mahārthiko\var{mahārthiko\lem \cod; mahārdhiko \Dutt} 'yaṃ mama
Pancavimsatisahasrika Prajnaparamita, V (psp_5u.htm.txt) 17272678 (0.042):
bodhau pratiṣṭhāpayati, ye 'nuttarāyāṃ samyaksaṃbodhau pratiṣṭhāpayitavyās
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540086 (0.045):
ñ1.13 dṛṣṭadharmikā guṇā daśa parigrahīyāḥ\var{parigrahīyāḥ\lem \cod;
Karunapundarikasutra (bsu018_u.htm.txt) 7653824 (0.047):
deśayeyaṃ, anuttarāyāṃ samyaksaṃbodhau samādāpayeyaṃ niveśayeyaṃ / pratiṣṭhāpayeyaṃ, avaivartikāṃśca sthāpayeyaṃ anuttarāyāṃ samyaksaṃbodhau
Ekadasamukham (bsu015_u.htm.txt) 21405103 (0.055):
sarvaduṣṭayakṣarākṣasānāmanena hṛdayena karṣitvā maitracittān dayācittān / kṛtvānuttarāyāṃ samyaksaṃbodhau pratiṣṭhāpayāmi / evaṃ mahardhiko 'yaṃ
Lalitavistara (bsu022_u.htm.txt) 9837670 (0.056):
mama bhavedakṛtajñatā ca, yadahamanuttarāyāṃ samyaksaṃbodhau / nābhisaṃbuddheyam // / atha te tuṣitakāyikā devaputrā rudanto bodhisattvasya caraṇau
Karunapundarikasutra (bsu018_u.htm.txt) 7670232 (0.058):
sattvā anuttarāyāṃ samyaksaṃbodhau samādāpitā niveṣitāḥ pratiṣṭhāpitā mama
Karunapundarikasutra (bsu018_u.htm.txt) 7643548 (0.058):
varṣaśatāṃ jambūdvīpamanvāhiṇḍya sarvasattvā anuttarāyāṃ samyaksaṃbodhau / yāvat pratiṣṭhāpiṭāḥ / tad evaṃ mayā sarvajambūdvīpe gatānekāni
Karunapundarikasutra (bsu018_u.htm.txt) 7645875 (0.060):
mahāyajñe tat sattvānāṃ saṃvibhajeyaṃ, anuttarāyāṃ samyaksaṃbodhau / samādāpayeyaṃ / sacedahamanena puṇyenānuttarāṃ
Nilakantha Diksita: Kalividambana (nkalivxu.htm.txt) 5548710 (0.060):
giram+ skhalantīm+ mīlantīm+ & dṛṣṭim+ pādau visaṃsthulau / \var{visaṃsthulau\lem \em; visaṃsphuṭau \ed} |
Padmagupta (alias Parimala): Navasahasankacarita (padnscxu.htm.txt) 10098254 (0.060):
dhṝtam udakam etya pṝṣṭhatas+\var{pṝṣṭhataḥ\lem \em; pṝṣṭataḥ \ed}
Karunapundarikasutra (bsu018_u.htm.txt) 7642750 (0.063):
pratiṣṭhāpayitvānuttarāyāṃ samyaksaṃbodhau cittamutpādayati / / tenaivamanvāhiṇḍatā na sa kaścijjambūdvīpe manuṣyabhūto (KpSū 62) 'sti yaḥ
bhagavat hṛ[dayam] ekavelāṃ prakāśitvā catvāro mūlāpattayaḥ kṣa[yaṃ]
Ekadasamukham (bsu015_u.htm.txt) 21405111 (0.018):
ekavelāṃ prakāśitvā cattvāro mūlāpattayaḥ kṣayaṃ gacchanti pacānantaryāṇi
gacchanti\var{gacchanti\lem \Dutt; gakṣanti \cod} .
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540087 (0.041):
ñ1.13 dṛṣṭadharmikā guṇā daśa parigrahīyāḥ\var{parigrahīyāḥ\lem \cod; / parigrahītavyāḥ\Dutt \em} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540278 (0.056):
yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540586 (0.062):
tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
pañcānantaryāṇi karmāṇi niravayaṃ tanvīkariṣyati / / kaḥ punar vādo yathābhāṣitaṃ pratipatsyanti / % Dutt supplies ``teṣāṃ ye''
Ekadasamukham (bsu015_u.htm.txt) 21405123 (0.036):
karmāṇi niravayavaṃ tanvīkariṣyanti / kaḥ punarvādo yathābhāṣitaṃ / pratipatsyanti /
Karunapundarikasutra (bsu018_u.htm.txt) 7640253 (0.052):
bodhisattvena mahāsattveneyaṃ dhāraṇī pratilabdhā bhavati tena yadi / pañcānantaryāṇī karmāṇyācīrṇāni bhavati, tasya janmāntareṇa (KpSū 40)
Ajitasenavyakarana (ajitsvyu.htm.txt) 1371437 (0.055):
śroṣyanti teṣāṃ pañcānantaryāṇi kṛtyāni parīkṣayaṃ yāsyanti | avaivartikās
Saddharmapundarikasutra (bsu036_u.htm.txt) 6601227 (0.064):
uttari cābhyanumodayiṣyanti | kaṃḥ punarvādo ye dhārayiṣyanti vācayiṣyanti
but better understand: ``why say more, these will happen as they are
Vaikhanasamantraprasna, Prasnas 5 - 8 (vaimp__u.htm.txt) 12143372 (0.024):
of manuscripts which he calls L. Goudriaan is unable to translate these / letters either as dhārāsāyā (which he incorrectly lists as dhārāsāya) or
Vaikhanasamantraprasna, Prasnas 5 - 8 (vaimp__u.htm.txt) 12156834 (0.033):
for accents. In this instance it more accurately reflects the RV than the
Kuḍaka's Samanvayadiś (SD) (samanv_u.htm.txt) 13215633 (0.035):
useful in determining relative chronology of the more important works of
Buddhasvamin: Brhatkathaslokasamgraha (brkas_pu.htm.txt) 5743805 (0.035):
to share it with everyone, who will find it useful. However you
Jiva Gosvami: Satsamdarbha, part 4: Krsnasamdarbha (ss4_krsu.htm.txt) 14396615 (0.036):
Shastri in 1983. The additions found in the Vṛ edition are probably / authentic, / as there is clear evidence Jiva Goswami made extensive corrections and
Vinayavastu, 15: Sayanasanavastu. (vinv15_u.htm.txt) 14808699 (0.036):
Upālin is the foremost amidst them who master and know the Vinaya. The
Vinayavastu, 15: Sayanasanavastu. (vinv15_u.htm.txt) 14810568 (0.036):
Upāli is the foremost amidst them who master and know the Vinaya. The
Sanghabhedavastu (vinv172u.htm.txt) 17979740 (0.038):
Ānanda is the foremost among the learned monks
Kiranatantra, chapters 1-6 (kirtc_au.htm.txt) 26639507 (0.038):
\Narayana\ quotes this unit exactly as / constituted ad \Mrg\ 13:160, p.133.}
Kiranatantra, chapters 1-6 (kirtc_pu.htm.txt) 10707529 (0.038):
/Narayana/ quotes this unit exactly as / constituted ad /Mrg/ 13:160, p.133.}
VATSYAYANA: KAMASUTRA (with notes) (kamasufu.htm.txt) 27943051 (0.039):
not turn back without going to the end, remaining fixed in the will of / spirited persons [19].; opinion qui se retrouve aussi en 1.17.30-32
Sanghabhedavastu (vinv172u.htm.txt) 17976569 (0.039):
Upāli is the foremost among those who master and know the Vinaya
Mrgendragama (=Mrgendratantra) (mrgt3mpu.htm.txt) 23122225 (0.039):
as well as to Mme Brunner's corrrections (1985:424--9), a number / of which derive from MSS that were not available to Bhatt.
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557129 (0.039):
Another feature which exceeds what might be expected from a
ASVAGHOSA: BUDDHACARITA (asvbc_1u.htm.txt) 1033193 (0.039):
variant if there is more than one) is closed by the closing
Kasyapaparivartasutra (kasyparu.htm.txt) 9785875 (0.040):
foll. 34-36 (KP-SI P/2) are lost. However, in fact there are only two
Sanghabhedavastu (vinv172u.htm.txt) 17998550 (0.042):
Ajātaśatru casts his father in prison, there to die of hunger
A Digital edition of the Abhisamacarika-Dharma (abhisdhu.htm.txt) 14493014 (0.042):
(1) The letters between ( ) indicate that they should be supplied. / (2) The letters which seem to be wrongly written are underlined.
Radhakrsnadasa Gosvami: Sadhanadipika (sadhdipu.htm.txt) 7598447 (0.042):
quotes, but I haven't been able to trace them. / I have used Haridas Shastri's edition, and have not had access to another.
taught'' / %sandhi dissolved from here on
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557005 (0.046):
the originally omitted initial a" being marked as sandhi vowel"
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557172 (0.055):
buddha+carita). In case of sandhi, the + functions also as
Gheranda-Samhita (ghers_au.htm.txt) 10187991 (0.055):
brahma+purana). In case of sandhi, the + functions also as sandhi-marker,
Gheranda-Samhita (ghers_au.htm.txt) 10187793 (0.055):
originally omitted initial a" being marked as sandhi vowel (e..g. devo*"
Gheranda-Samhita (ghers_au.htm.txt) 10187763 (0.056):
In case of vowel sandhi the above--mentioned principle of transliteration
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556899 (0.057):
consequently typed) letter has undergone some sandhi change. / A sandhi change is defined with regard to the pausa form" of"
Gheranda-Samhita (ghers_au.htm.txt) 10187666 (0.057):
changes. / A sandhi change is defined with regard to the pausa form" of a word
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556989 (,0.059):
In case of vowel sandhi the sandhi is dissolved and marked"
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557013 (0.063):
In some special cases the marking of sandhi has to be extended
Gheranda-Samhita (ghers_au.htm.txt) 10187802 (0.063):
In some special cases the marking of sandhi has to be extended to include
Gheranda-Samhita (ghers_au.htm.txt) 10187778 (0.063):
sandhi is dissolved and marked (e..g. na*asti, ca*eva). Similarly,
Buddhasvamin: Brhatkathaslokasamgraha (brkas_pu.htm.txt) 5743866 (0.063):
The input is based on the TZ Format created by Peter Schreiner / and others, which marks sandhi and composita. Only personal
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556831 (0.064):
{\colophons} / {analysis} / {sandhi} / The principle of transliteration" has been that the input format"
aneka-buddha-śata-sahasra-avaropita-kuśala-mūlā bhaviṣyanti\var{mūlā
Vajracchedika Prajnaparamita (bsu051_u.htm.txt) 4087930 (5.960):
bhaviṣyanti | api tu khalu punaḥ subhūte anekabuddhaśatasahasraparyupāsitā / anekabuddhaśatasahasrāvaropitakuśalamūlāste bodhisattvā mahāsattvā
Saddharmapundarikasutra (bsu036_u.htm.txt) 6561737 (0.018):
brahmacāriṇo bahubuddhaśatasahasrāvaropitakuśalamūlāśca te rājakumārā
Saddharmapundarikasutra (bsu036_u.htm.txt) 6597921 (0.018):
bahubuddhaśatasahasrāvaropitakuśalamūlā bahukalpaśatasahasrapariniṣpannāḥ
Karunapundarikasutra (bsu018_u.htm.txt) 7635911 (0.019):
(KpSū 3) / bahubuddhaśatasahasrāvaropitakuśalamūlairbahubuddhaśatasahasrasaṃstutairmaitrīparibhāvitakāyacittaistathāgatajñānāvatāraṇakuśalairmahāprajñaiḥ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6559526 (0.019):
dhāraṇīpratilabdhairmahāpratibhānapratiṣṭhitairavaivartyadharmacakrapravartakairbahubuddhaśataparyupāsitairbahubuddha / śatasahasrāvaropitakuśalamūlairbuddhaśatasahasrasaṃstutairmaitrīparibhāvitakāyacittaistathāgatajñānāvatāraṇakuśalairmahāprajñaiḥ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6612753 (0.019):
bahubuddhaśatasahasrāvaropitakuśalamūlaḥ kṛtabuddhaparikarmā |
Ekadasamukham (bsu015_u.htm.txt) 21405129 (0.021):
anekabuddhaśatasahastrāvaropitakuśalamūlaṃ bhaviṣyati / ye śroṣyanti
Saptasatika prajnaparamita (bsu052_u.htm.txt) 1161742 (0.025):
buddhasahasrāvaropitakuśalamūlā bhaviṣyanti, ye imaṃ gambhīraṃ
Sukhavativyuha, Vistaramatrika (bsu033_u.htm.txt) 21413672 (0.026):
ete lakṣakoṭīniyutaśatasahasrāvaropitakuśalamūlā utpāṭitamānaśalyā
SUKHAVATIVYUHA (sukhvylu.htm.txt) 16532224 (0.036):
ye te bahubuddhakoṭīnayutaśatasahasrāvaropitakuśalamūlā,
Saddharmapundarikasutra (bsu036_u.htm.txt) 6568017 (0.038):
bodhisattvā bhaviṣyanti | ciracaritakuśalamūlā / bahubuddhaśatasahasracīrṇabrahmacaryāḥ, tathāgataparisaṃstutā
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142013 (0.038):
niyutaśatasahasrāvaropitakuśalamūlāste bhagavan sattvā bhaviṣyanti / ya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16994476 (0.038):
anekabuddhakoṭiniyutaśatasahasrāvaropitakuśalamūlās te bhagavan sattvā
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9086202 (0.039):
pūrvajinakṛtādhikārā avaropitakuśalamūlā / bahubuddhakoṭīniyutaśatasahasraparyupāsitā dharmikāśca dharmavādinaśca
SUKHAVATIVYUHA (sukhvylu.htm.txt) 16533285 (0.053):
pariniṣpannānām avaivarttikānāṃ bahubuddhakoṭī- / śatasahasrāvaropitaiḥ kuśalamūlaiḥ. kaḥ punar vādas, tataḥ
Vajracchedika Prajnaparamita (bsu051_u.htm.txt) 4087915 (0.057):
mahāsattvā ekabuddhaparyupāsitā bhaviṣyanti, naikabuddhāvaropitakuśalamūlā / bhaviṣyanti | api tu khalu punaḥ subhūte anekabuddhaśatasahasraparyupāsitā
Vajracchedika Prajnaparamita (vchedppu.htm.txt) 27680335 (0.060):
naikabuddhāvaropitakuśalamūlā bhaviṣyaṃti / api tu khalu punaḥ subhūte
bhaviṣyanti\lem \cod;
Ekadasamukham (bsu015_u.htm.txt) 21405135 (0.050):
anekabuddhaśatasahastrāvaropitakuśalamūlaṃ bhaviṣyati / ye śroṣyanti / prāgeva japasādhanādibhiḥ / sarvamanorathaṃ paripūrayiṣyāmi yaśca
japa-sādhana-ādibhiḥ /% prāg eva: ``how much more...''
Ekadasamukham (bsu015_u.htm.txt) 21405137 (0.0):
anekabuddhaśatasahastrāvaropitakuśalamūlaṃ bhaviṣyati / ye śroṣyanti / prāgeva japasādhanādibhiḥ / sarvamanorathaṃ paripūrayiṣyāmi yaśca
sarva-manoratham- paripūrayiṣyāmi . / ye ca\var{ye ca\lem \em; yaśca \cod} caturdaśīpañcadaśī\com{dual loc.
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540529 (0.059):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
hybrid? \Dutt: ``should be caturdaśyāṃ pañcadaśyāṃ''.} mām- uddiśya-
upavasante\var{upavasante \cod; upavasati \Dutt} {/}
catvāriṃśa kalpa-sahasrāṇi saṃsārā paścāt-mukhīkariṣyanti /
tena nā[madhe]yam- api grahaṇena bhagavan- saha sas- ayam-
buddha-koṭī-niyuta-śata-sahasra-atireka-samam /
Ekadasamukham (bsu015_u.htm.txt) 21405164 (0.0):
saṃsārān paścānmukhīkarisyanti / tena nāmadheyamapi grahaṇena bhagavan / saha so 'yaṃ buddhakoṭīniyutśatasahasrātirekasamam / mama
Pancavimsatisahasrika Prajnaparamita, IV (psp_4u.htm.txt) 1637972 (0.033):
bahubuddhakoṭīniyutaśatasahasraparyupāsitā bhaviṣyanti,
Pancavimsatisahasrika Prajnaparamita, V (psp_5u.htm.txt) 17261471 (0.033):
bahubuddhakoṭīniyutaśatasahasraparyupāsitaḥ sa bodhisattvo mahāsattvaḥ
Sukhavativyuha, Vistaramatrika (bsu033_u.htm.txt) 21413841 (0.033):
bahubuddhakoṭīniyutaśatasahasrāvaropitakuśalamūlān | samanantarabhāṣitā
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9086206 (0.033):
bahubuddhakoṭīniyutaśatasahasraparyupāsitā dharmikāśca dharmavādinaśca
Lalitavistara (bsu022_u.htm.txt) 9835982 (0.034):
daśadiganekabuddhakoṭīniyutaśatasahasrasamanvāhṛte
Gandavyuhasutra (bsu016_u.htm.txt) 28679579 (0.036):
lokadhātau samāpadyate kalpe 'śītibuddhakoṭīniyutaśatasahasraprabhave /
Santideva: Siksasamuccaya (sanssr_au.htm.txt) 3734406 (0.039):
an eka ratna koṭī niyuta śata sahasra alaṃ kāra vyūhāni
Sukhavativyuha, Vistaramatrika (bsu033_u.htm.txt) 21407058 (0.040):
lokadhātukoṭīniyutaśatasahasradarśanatayāpi, mā tāvadahamanuttarāṃ
Gandavyuhasutra (bsu016_u.htm.txt) 28601710 (0.040):
buddhakṣetrakoṭīniyutaśatasahasraparamāṇurajaḥsamānapi,
Gandavyuhasutra (bsu016_u.htm.txt) 28634603 (0.040):
daśānabhilāpyabuddhakṣetrakoṭīniyutaśatasahasraparamāṇurajaḥsameṣu
SUKHAVATIVYUHA (sukhvylu.htm.txt) 16525704 (0.040):
bhaveyur, antaśa ekacittakṣaṇalavena buddhakṣetrakoṭīniyuta- / śatasahasrātikramaṇatayāpi, mā tāvad aham anuttarāṃ
Sukhavativyuha, Vistaramatrika (bsu033_u.htm.txt) 21407002 (0.040):
buddhakṣetrakoṭīniyutaśatasahasrātikramaṇatayāpi, mā tāvadahamanuttarāṃ
Sukhavativyuha, Vistaramatrika (bsu033_u.htm.txt) 21407116 (0.040):
buddhakṣetrakoṭīniyutaśatasahasraparyāpannānāmapi sattvānāṃ
Sukhavativyuha, Vistaramatrika (bsu033_u.htm.txt) 21407225 (0.040):
buddhakṣetrakoṭīniyutaśatasahasrapramāṇenāpi, mā tāvadahamanuttarāṃ
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9088184 (0.040):
gaṅgānadīvālukopamāni buddhakṣetrakoṭīniyutaśatasahasrāṇyabhāsitāni
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142009 (0.042):
amoghapāśahṛdayaṃ pracariṣyati / aneka buddhakoṭi / niyutaśatasahasrāvaropitakuśalamūlāste bhagavan sattvā bhaviṣyanti / ya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16994472 (0.042):
anekabuddhakoṭiniyutaśatasahasrāvaropitakuśalamūlās te bhagavan sattvā
Gandavyuhasutra (bsu016_u.htm.txt) 28601610 (0.043):
buddhakoṭīsahasramapi, buddhakoṭiśatasahasramapi, / buddhakoṭīniyutaśatasahasramapi,
Gandavyuhasutra (bsu016_u.htm.txt) 28667500 (0.043):
bahukalpakoṭīniyutaśatasahasraparyavasānena, na
mama nāmadheya-grahaṇena [sa]rva-sattvās- avaivartikatvaṃ prasavanti{ḥ} /
Ekadasamukham (bsu015_u.htm.txt) 21405170 (0.0):
saha so 'yaṃ buddhakoṭīniyutśatasahasrātirekasamam / mama / nāmadheyagrahaṇenasarvasattvā avaivartikatvaṃ prasavanti /
sarvavyādhibhis- parimucyante\var{parimucyante\lem \cod; parimucyate
\Dutt} / / sarva-āvaraṇebhya[s-] sarva-bhayebhyas- / sarva-kāya-vāk-manas-duścaritebhyas- parimokṣyante /
Manjusrinamasamgiti (manjnspu.htm.txt) 3041748 (0.049):
nāmasaṃgitistavānuttaraprītiprāsādamahodvilya saṅjananārthahṃ, / kāyavāṅmanoguhyapariśuddhyai,
Yajnavalkya-Smrti (yajn1_u.htm.txt) 16018376 (0.051):
Yāj1.225c/ taiś ca^api samyatair (bhāvyam mano.vāk.kāya.karmabhih //
Abhinavagupta: Malinislokavarttika, Kanda 1 (abhmal1u.htm.txt) 26387351 (0.058):
tadguṇatrayasadbhāve manovākkāyasambhuvām // 1.336 // / karmaṇāṃ saṃciter eṣa karmabhāgīti cen nanu
Pancavimsatisahasrika Prajnaparamita (pspdut2u.htm.txt) 6906866 (0.060):
07215 sāvadyasya kāyavāṅmanaskarmano 'vakāśo na dātavyaḥ kāyavāṅmana / 07216 skarmapariśuddhaye ca śikṣitavyam/ [itīdam
Yasomitra: Sphutartha Abhidharmakosavyakhya (yabhkvyu.htm.txt) 11876375 (0.061):
pravartata ity arthaḥ. anālambakatvāc ca. kāyavākkarmāpy anālambakatvād
Pauskara-Samhita (ps27-43u.htm.txt) 28872497 (0.061):
manovākkāyakarmaistu āprabhātāmṛniśāvadhi /
Vasubandhu: Abhidharmakosa-bhasya (vakobhau.htm.txt) 24008114 (0.061):
teṣāmāyuṣman kāyavāṅmanovaṅkānāṃ kāyavāṅmanodoṣakaṣāyāṇā narakeṣu rūpaṃ
Nagarjuna: Salistambakamahayanasutratika (nagsaliu.htm.txt) 16515401 (0.063):
kṣetra-vidyā-vyāpāra-rājyādi-svaparāpakāri-kāya-vāk-citta-pravṛtta-vividhākārārabdhāḥ
Santideva: Siksasamuccaya (sanssr_au.htm.txt) 3766863 (0.063):
kāya karma vāk karma manas karma sa curitaṃ ṣaṇṇām indriyāṇāṃ saṃvaraḥ
teṣām- eva kara-tala-gatā- buddha-bodhis- bhaviṣyati /\marginpar{\Dutt
Prajnakaramati: Bodhicaryavatarapanjika (bsa054_u.htm.txt) 19460856 (0.051):
bodhisattvena svārādhitaḥ kartavyaḥ supratibiddhaḥ / tasya karatalagatāḥ / sarve buddhadharmā bhavanti / tadyathā yena
bhagavān āha / / sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
Ekadasamukham (bsu015_u.htm.txt) 21405196 (1.788):
39) buddhabodhirbhaviṣyati / bhagavānāha / sādhu sādhu kulaputra yat
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540316 (0.004):
trāṇam śaraṇam parāyaṇaṃ bhavāmi yat\var{yat\lem \Dutt; yaḥ \cod} /
Karunapundarikasutra (bsu018_u.htm.txt) 7653960 (0.005):
vācāsminnevameva svayaṃ paśyati yathā praṇidhānaṃ kṛtaṃ iti / / bhagavān āha "sādhu sādhu kulaputra
Mahasannipataratnaketudharanisutra (Ratnaketuparivarta) (Parivartas 1-6, 10-11) (bsu024_u.htm.txt) 12477112 (0.011):
bhagavānāha / sādhu sādhu kulaputra subhāṣitaste 'yamekanayena (Dutt 34)
Astasahasrika Prajnaparamita (bsu049_u.htm.txt) 4063779 (0.020):
tathotkaṇṭhitasya tathāgatavigrahaḥ purataḥ sthitvā sādhukāramadāt sādhu / sādhu kulaputra, yastvamenāṃ vācaṃ bhāṣase / evaṃ hi kulaputra paurvakair
Gandavyuhasutra (bsu016_u.htm.txt) 28600826 (0.020):
śreṣṭhidārakametadavocat sādhu sādhu kulaputra, yastvamanuttarāyāṃ
Gandavyuhasutra (bsu016_u.htm.txt) 28601100 (0.020):
śreṣṭhidārakametadavocat sādhu sādhu kulaputra, yastvamanuttarāyai
Gandavyuhasutra (bsu016_u.htm.txt) 28601457 (0.020):
meghaśrīrbhikṣuḥ sudhanaṃ śriṣṭhidārakametadavocat sādhu sādhu / kulaputra, yastvamanuttarāyāṃ samyaksaṃbodhau cittamutpādya
Gandavyuhasutra (bsu016_u.htm.txt) 28604021 (0.020):
evamukte supratiṣṭhito bhikṣuḥ sudhanaṃ śreṣṭhidārakametadavocat sādhu / sādhu kulaputra, yastvamanuttarāyāṃ samyaksaṃbodhau cittamutpādya
Gandavyuhasutra (bsu016_u.htm.txt) 28631696 (0.020):
sādhu sādhu kulaputra, yastvamanuttarāṃ samyaksaṃbodhimabhisaṃprasthitaḥ /
Gandavyuhasutra (bsu016_u.htm.txt) 28633443 (0.020):
pratipattavyam / āha sādhu sādhu kulaputra, yastvamanuttarāyāṃ
Gandavyuhasutra (bsu016_u.htm.txt) 28642334 (0.020):
evamukte vāsantī rātridevatā sudhanaṃ śreṣṭhidārakamevamāha sādhu sādhu / kulaputra, yastvamevaṃ kalyāṇamitrāveśāviṣṭaḥ kalyāṇamitravacanāni
Gandavyuhasutra (bsu016_u.htm.txt) 28645293 (0.020):
carati, kathaṃ niryāti, kathaṃ pariniṣpadyate? āha sādhu sādhu / kulaputra, yastvamanuttarāyāṃ samyaksaṃbodhau cittamutpādya
Gandavyuhasutra (bsu016_u.htm.txt) 28656952 (0.020):
śreṣṭhidārakametadavocat sādhu sādhu kulaputra, yastvaṃ
Gandavyuhasutra (bsu016_u.htm.txt) 28681843 (0.020):
evamukte gopā śākyakanyā sudhanaṃ śreṣṭhidārakametadavocat sādhu sādhu / kulaputra, yastvaṃ bodhisattvānāmimāmevaṃrūpāṃ caryāṃ dharmatāṃ
Karandavyuha (bsu019_u.htm.txt) 7108009 (0.020):
sādhukāramadāt - sādhu sādhu kulaputra, yastvamevaṃ punaḥ
Karandavyuha (bsu019_u.htm.txt) 7109146 (0.020):
viśramitvā sādhukāramanuprayanti - sādhu sādhu kulaputra, yastvamīdṛśaṃ
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444359 (0.020):
mahākaruṇikāya sādhukāramadāt - sādhu sādhu kulaputra, yastvaṃ
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540586 (0.024):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
sarva-sattvānām- antike- evam-rūpā\var{evaṃrūpā\lem \Dutt; evaṃrūpaṃ}
mahā-karuṇā / / śakṣyasi tvaṃ kula-putra\var{kulaputra\lem \em; kulaputraḥ \Dutt} anena-
Ekadasamukham (bsu015_u.htm.txt) 21405205 (0.029):
sarvasattvānāmantike evaṃrūpā mahākaruṇā / śakṣyasi tvaṃ kulaputraḥ
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540527 (0.050):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540584 (0.053):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
Karunapundarikasutra (bsu018_u.htm.txt) 7653962 (0.054):
bhagavān āha sādhu sādhu kulaputra
upāyena {sarva}sarva-sattvānā[m- anuttarā]yāṃ\var{sattvānām\lem \Dutt;
sattvān* \cod} samyak-saṃbodhau pratiṣṭhāpayitum / udgṛhītam-
ca\var{udgṛhīto yaṃ \cod} [mayā] hṛdayam- anumoditam /
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540315 (0.022):
trāṇam śaraṇam parāyaṇaṃ bhavāmi yat\var{yat\lem \Dutt; yaḥ \cod} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540986 (0.023):
(illegible in photo); bhagavān \Dutt} āryāvalokiteśvara sva-bhavanam-
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540532 (0.024):
sādhu sādhu kula-putra yat te\var{yat te\lem \cod; yat \Dutt}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540278 (0.030):
pra[tila]bdham / \marginpar{\Dutt p.38} / yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
Ekadasamukham (bsu015_u.htm.txt) 21405224 (0.041):
udgṛhītaṃ camayā hṛdayamanumoditam / bhāṣadhvaṃ kulaputra / tataḥ
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18539999 (0.045):
\Dutt}rājā\var{rājā\lem \cod; rājasya \em \Dutt} nāma tathāgata{ta}sya{ā}
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540087 (0.052):
ñ1.13 dṛṣṭadharmikā guṇā daśa parigrahīyāḥ\var{parigrahīyāḥ\lem \cod; / parigrahītavyāḥ\Dutt \em} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540552 (0.053):
śakṣyasi tvaṃ kula-putra\var{kulaputra\lem \em; kulaputraḥ \Dutt} anena-
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23141891 (0.061):
atha khalu āryāvalokiteśvaro bodhisattvo mahāsattva utthāyāsanādekāṃ
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142632 (0.061):
pitṛkāryakariṣyanti / atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo
Amoghapasahrdayasutra (amoghapu.htm.txt) 16994354 (0.061):
atha khalu āryāvalokiteśvaro bodhisattvo mahāsattva utthāyāsanād ekāṃsam
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995106 (0.061):
atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo 'nimiṣanayano bhūtvā
Ekadasamukham (bsu015_u.htm.txt) 21404775 (0.061):
ca / atha khalvāryāvalokiteśvaro bodhisattvo mahāsattvo
Prajnakaramati: Bodhicaryavatarapanjika (bsa054_u.htm.txt) 19460834 (0.061):
atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo bhagavantametadavocat
Srimahadevivyakaranam (bsu007_u.htm.txt) 7926080 (0.061):
atha khalvāryāvalokiteśvaro bodhisattvo mahāsattvo yena
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444410 (0.061):
atha khalu āryāvalokiteśvaro bodhisattvo mahāsattvo bhagavantametadavocat
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18539806 (0.061):
ca \Dutt} / / ñ1.2 atha khalv āryāvalokiteśvaro bodhisa[ttvo] mahāsattvo
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540371 (0.062):
gacchanti\var{gacchanti\lem \Dutt; gakṣanti \cod} .
bodhisattvo\var{bodhisattva \Dutt} utthāya- āsanāt- eka-aṃsam-
Amoghapasahrdayasutra (amoghapu.htm.txt) 16994360 (0.042):
atha khalu āryāvalokiteśvaro bodhisattvo mahāsattva utthāyāsanād ekāṃsam
Karandavyuha (bsu019_u.htm.txt) 7098755 (0.042):
atha tasminneva parṣanmadhye sarvanīvaraṇaviṣkambhī nāma bodhisattvo / mahāsattva utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ
Pratityasamutpadamahayanasutra (bsu026_u.htm.txt) 6216311 (0.042):
gandharvarājena pañcaśikhena ca sārdham | athāvalokiteśvaro bodhisattvo / mahāsattvaḥ utthāyāsanāt ekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānuṃ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6611719 (0.042):
bodhisattvo mahāsattva utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ
Samghatasutra (bsu045_u.htm.txt) 7821059 (0.042):
[SaSū 9] atha khalu sarvaśūro bodhisattvo mahāsattvaḥ / utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Samghatasutra (bsu045_u.htm.txt) 7821895 (0.042):
[SaSū 30] atha khalu sarvaśūro bodhisattvo mahāsattva utthāyāsanād / (ekāṃsamuttarāsaṃgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ pratiṣṭhāpya
Samghatasutra (bsu045_u.htm.txt) 7822317 (0.042):
[SaSū 35] atha khalu sarvaśūro bodhisattvo mahāsattva utthāyāsanād / ekāṃsamuttarāsaṃgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ pratiṣṭhāpya
Samghatasutra (bsu045_u.htm.txt) 7832632 (0.042):
[SaSū 216] atha khalu bhaiṣajyaseno bodhisattvo mahāsattvaḥ / utthāyāsanādekāṃsaṃ cīvaraṃ prāvṛtya dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Suvarnaprabhasasutra (Suvarnabhasottamasutra) (bsu035_u.htm.txt) 9101034 (0.042):
atha khalu ruciraketubodhisattva utthāyāsanādekāṃsamuttarāsaṅgaṃ
Karandavyuha (bsu019_u.htm.txt) 7103951 (0.045):
atha teṣāṃ bodhisattvenāṃ madhye gaganagañjo nāma bodhisattva / utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Karandavyuha (bsu019_u.htm.txt) 7100090 (0.046):
atha tasminneva parṣadi ratnapāṇirnāma bodhisattvo mahāsattva / utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6607992 (0.046):
atha khalu bhaiṣajyarājo bodhisattvo mahāsattva / utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6613373 (0.046):
atha khalu akṣayamatirbodhisattvo mahāsattva / utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Saddharmapundarikasutra (bsu036_u.htm.txt) 6614917 (0.046):
atha khalu dharaṇiṃdharo bodhisattvo mahāsattva / utthāyāsanādekāṃsamuttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Samghatasutra (bsu045_u.htm.txt) 7828663 (0.046):
[SaSū 146] atha khalu maitreyo bodhisattvo mahāsattva / utthāyāsanādekāṃsamuttarāsaṃgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Samghatasutra (bsu045_u.htm.txt) 7828854 (0.046):
[SaSū 152] atha khalu sarvaśūro bodhisattvo mahāsattva / utthāyāsanādekāṃsamuttarāsaṃgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyaṃ
Samghatasutra (bsu045_u.htm.txt) 7830335 (0.046):
[SaSū 183] atha khalu bhaiṣajyaseno bodhisattvo mahāsattva / utthāyāsanādekāṃsamuttarāsaṃgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ
Avadanasataka (avsata_u.htm.txt) 5631770 (0.055):
samādāpayati | atha sa rājā labdhaprasāda utthāyāsanād ekāṃsam / uttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ pratiṣṭhāpya
Avadanasataka (avsata_u.htm.txt) 5699630 (0.055):
utthāyāsanād ekāṃsam uttarāsaṅgaṃ kṛtvā yena bhagavāṃs tenāñjaliṃ
Bhaisajyaguruvaiduryaprabharajasutra (bsu012_u.htm.txt) 8361544 (0.055):
mahāsattvaḥ saṃnipatito 'bhūt saṃniṣaṇṇaḥ | utthāyāsanād ekāṃsam / uttarāsaṅgaṃ kṛtvā dakṣiṇaṃ jānumaṇḍalaṃ pṛthivyāṃ pratiṣṭhāpya yena
uttara-āsaṅgam- kṛtvā bhagavatas- caraṇayos- praṇipatya{m} idam- hṛdayam-
Ekadasamukham (bsu015_u.htm.txt) 21405235 (0.022):
khalvāryāvalokiteśvaro bodhisattva utthāyasanādekāṃsamuttarāsaṅga kṛtvā / bhagavataścaraṇayoḥ praṇipatya idaṃ hṛdayamāvartayati sma /
āvartayati sma // / namas- ratnatrayāya / / namas- vairocanāya tathāgatāya /
Ekadasamukham (bsu015_u.htm.txt) 21405241 (0.029):
bhagavataścaraṇayoḥ praṇipatya idaṃ hṛdayamāvartayati sma / / namo ratnatrayāya / namo vairocanāya tathāgatāya / nama
namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
108 Buddhist stotras (bst-108u.htm.txt) 3686580 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995349 (0.0):
sakalabuddhadharmaparipūrṇāya svāhā / namo ratnatrayāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540702 (0.0):
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540812 (0.0):
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540839 (0.0):
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540952 (0.0):
[na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
Ekadasamukham (bsu015_u.htm.txt) 21405248 (0.0):
namo ratnatrayāya / namo vairocanāya tathāgatāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namaḥ
Ekadasamukham (bsu015_u.htm.txt) 21405371 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405409 (0.0):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405432 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Karandavyuha (bsu019_u.htm.txt) 7097548 (0.0):
śrīāryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya //
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444351 (0.008):
atha khalu bhagavān āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142837 (0.011):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405284 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405309 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Hayagrivavidya (bsu017_u.htm.txt) 27758089 (0.011):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540780 (0.024):
namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / / tat- yathā siri siri dhiri dhiri siri dhiri\var{siri siri \lem \em based
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540749 (0.033):
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540903 (0.052):
namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya / / tat- yathā ili mili pili\var{pili\lem from Chinese; \omitted \Dutt} tili /
namas-\var{nama\lem \em; namaḥ \cod\Dutt}
atīta-anāgata-pratyutpa[nnebhyaḥ]\var{missing in Chinese 1071}
Mahasannipataratnaketudharanisutra (Ratnaketuparivarta) (Parivartas 1-6, 10-11) (bsu024_u.htm.txt) 12488695 (0.049):
Chapter 7 is missing in the Original text Gilgit Manuscripts Vol IV""
Mahasannipataratnaketudharanisutra (Ratnaketuparivarta) (Parivartas 1-6, 10-11) (bsu024_u.htm.txt) 12488708 (0.049):
Chapter 8 is missing in the Original text Gilgit Manuscripts Vol IV""
Mahasannipataratnaketudharanisutra (Ratnaketuparivarta) (Parivartas 1-6, 10-11) (bsu024_u.htm.txt) 12488721 (0.049):
Chapter 9 is missing in the Original text Gilgit Manuscripts Vol IV""
Harivamsa, Appendix I. (hv_appau.htm.txt) 577333 (0.055):
anuśocyātha paulomī $ guṇaḥ ka iha dṛśyate // HV_App.I,29.655 // / [k: ka is missing in the cr. ed. :k]
Harivamsa, Appendix I. (hv_apppu.htm.txt) 22062884 (0.055):
anuśocyātha paulomī guṇaḥ ka iha dṛśyate // HV_App.I,29.655 // / [k: ka is missing in the cr. ed. :k]
Dramatic Fragments (buddhist) (dramfrag_tu.htm.txt) 850784 (0.063):
akṣaras in italics/bold still missing (probably restored from SHT 57a r2
sarva-tathāgatebhyas- arhadbhyaḥ samyak-saṃbuddhebhyaḥ / / oṃ diri diri\var{diri diri\lem \em; dhara dhara dhiri dhiri \Dutt from
Manjusrimulakalpa (bsu041_u.htm.txt) 11456620 (0.054):
namaḥ sarvatathāgate 'bhyo 'rhadbhyaḥ samyak sambuddhebhyaḥ / om
Tib} / dhuru dhuru / iṭṭe viṭṭe / cale cale / pracale pracale /
Ekadasamukham (bsu015_u.htm.txt) 21405271 (0.0):
omdhara dhara / dhiri dhiri / dhuru dhuru / iṭṭe viṭṭe / cale cale /
[kusume]\var{kusume\em supplied from Tib also in Chinese} kusumavare / ili
A Digital edition of the Abhisamacarika-Dharma (abhisdhu.htm.txt) 14493030 (0.041):
Immediately after them suggestion is supplied between ( ). / (3) Letters in blue and underlined are to be omitted. No suggestion is
Ekadasamukham (bsu015_u.htm.txt) 21405275 (0.043):
omdhara dhara / dhiri dhiri / dhuru dhuru / iṭṭe viṭṭe / cale cale / / pracale pracale / kusume kusumavare / ili mili viṭi svāhā / evaṃ
Sanghabhedavastu (vinv172u.htm.txt) 17995375 (0.045):
Śroṇakoṭīviṃśa and King Bimbisāra go together to the Bamboo grove in order / to see the Buddha
Gheranda-Samhita (ghers_au.htm.txt) 10187462 (0.045):
regarding the wording of the text. The exact place of this sign may differ / slightly from where it is
Sanghabhedavastu (vinv172u.htm.txt) 18006616 (0.047):
The elephant Dhanapālaka follows submissively the Buddha, dies of grief / and is reborn in the heaven of the four great kings
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556438 (0.048):
edition. (The conventions for inputting variants are described / below.) Proof--reading and insertion of variants was done
Vaikhanasamantraprasna, Prasnas 5 - 8 (vaimp__u.htm.txt) 12150611 (0.048):
The complete verse is as follows (I have underlined the Sanskrit and / English that appears in the VMP text): agne mahāṅ asīty āha mahān hy eṣa
Buddhasvamin: Brhatkathaslokasamgraha (brkas_pu.htm.txt) 5743835 (0.049):
corrected. In a few cases I also adopted a different reading, when / it seemed to make more sense. It is also an uncorrected version.
Varahamihira: Brhatsamhita (brhats_u.htm.txt) 10202204 (0.051):
Varitants for the part beginning with * are supplied in [ ] .
DHARMAKIRTI: NYAYABINDU (dhknyayu.htm.txt) 7082180 (0.051):
lot of / errors and defects in this version. I would appreciate it very much if the
Vaikhanasamantraprasna, Prasnas 5 - 8 (vaimp__u.htm.txt) 12141885 (0.052):
vertical lines above the syllable, in the published text. / [*3] cf. Kāśyapa Jñāna Kāṇḍaḥ, chapter 34, vīśa hīne ripu vṛddhiḥ.
Suvarnavarnavadana (sutra) (suvrnavu.htm.txt) 28751250 (0.052):
( for a verse in Tibetan corresponding to Udānavarga VIII.6)
Buddhasvamin: Brhatkathaslokasamgraha (brkas_pu.htm.txt) 5743806 (0.052):
to share it with everyone, who will find it useful. However you / should know that there are certain deviations from Lac%
Vaikhanasamantraprasna, Prasnas 5 - 8 (vaimp__u.htm.txt) 12147633 (0.053):
[*98] Question mark appears in the VMP text and also in the following
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23558060 (0.053):
and may include frequencies (absolute and relative) and / formatting commands for the output.
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556507 (0.053):
typed in front of the letter to which they belong. This imitates
mili ciṭi\var{ciṭi\lem \cod; viṭi \Dutt} svāhā /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540962 (0.033):
tat- yathā piṭi piṭi tiṭi tiṭi / viṭi\var{viṭi viṭi\lem \cod; siṭi siṭi
Ekadasamukham (bsu015_u.htm.txt) 21405275 (0.053):
pracale pracale / kusume kusumavare / ili mili viṭi svāhā / evaṃ
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] //
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540276 (0.063):
pra[tila]bdham / \marginpar{\Dutt p.38} / yena\var{ye\lem \Dutt; yena \cod} bandhanabaddhā ye
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540618 (0.0):
namas- vairocanāya tathāgatāya / / namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540749 (0.0):
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.} / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540780 (0.0):
dhū[pa-dī]pa-nivedana-mantraḥ / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540811 (0.0):
gandha-puṣpa-<*>upanivedana-mantras- / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540837 (0.0):
bali-nivedana-mantras- eka-viṃśati-japena / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
108 Buddhist stotras (bst-108u.htm.txt) 3686577 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142836 (0.015):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405284 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405309 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405369 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405407 (0.015):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Hayagrivavidya (bsu017_u.htm.txt) 27758088 (0.015):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995346 (0.019):
sakalabuddhadharmaparipūrṇāya svāhā / namo ratnatrayāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Ekadasamukham (bsu015_u.htm.txt) 21405246 (0.019):
namo ratnatrayāya / namo vairocanāya tathāgatāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namaḥ
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540950 (0.025):
namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
Ekadasamukham (bsu015_u.htm.txt) 21405430 (0.025):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahākāruṇikāya / tadyathā piṭi piṭi tiṭi tiṭi viṭi viṭi gaccha gaccha
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444350 (0.033):
atha khalu bhagavān āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540896 (0.041):
tatas- karmaṃ\var{karmaṃ\lem \cod BH; karma \Dutt} samārabhet / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukham (bsu015_u.htm.txt) 21405325 (0.053):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyā mahāsattvāyā /
tat- yathā ha ha ha ha\var{ha ha ha ha\lem \cod; hā [hā hā] hā \Dutt} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540763 (0.0):
tat- yathā ṭuru ṭuru ha ha ha ha\var{ha ha ha ha\lem \cod; hā hā hā hā
ime tile cile bhile khile svāhā / / snāna-upaspṛśana\var{
Ekadasamukham (bsu015_u.htm.txt) 21405293 (0.0):
tad yathā hāhā hāhā / ime tile cile bhile khile svāhā /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540087 (0.047):
ñ1.13 dṛṣṭadharmikā guṇā daśa parigrahīyāḥ\var{parigrahīyāḥ\lem \cod; / parigrahītavyāḥ\Dutt \em} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540371 (0.051):
gacchanti\var{gacchanti\lem \Dutt; gakṣanti \cod} .
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540585 (0.064):
bhāṣadhva kula-putra / / tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
\Dutt}-vastra-abhyukṣipaṇa-mantras- sapta-jāpena /\com{abhyukṣipaṇa-\lem
Ekadasamukham (bsu015_u.htm.txt) 21405299 (0.023):
snānopasparśanavastrābhyukṣipaṇamantraḥ saptajāpena / (Em 40)
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.}
A Digital edition of the Abhisamacarika-Dharma (abhisdhu.htm.txt) 14493014 (0.062):
(2) The letters which seem to be wrongly written are underlined.
Bhagavadgita 18 (bhg4c18u.htm.txt) 6830444 (0.063):
[*ENDNOTE] Krishnadas gives bhartṛtve as an alternative reading both here / and further down.
Kautilya: Arthasastra (kautil_u.htm.txt) 5591435 (0.063):
(ḷaw of capital punishment, simple and with torture)
Bhamaha: Kavyalamkara (bhakavpu.htm.txt) 4073912 (0.064):
%% Is it that the foot is first compared" to a measuring rod and then / with a mirror for the faces of the celestial women that makes this"
Vaikhanasamantraprasna, Prasnas 5 - 8 (vaimp__u.htm.txt) 12143015 (0.064):
what appears to be a second r is actually a symbol for final n with one
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540702 (0.0):
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] // / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540810 (0.0):
gandha-puṣpa-<*>upanivedana-mantras- / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540836 (0.0):
bali-nivedana-mantras- eka-viṃśati-japena / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540617 (0.033):
namas- vairocanāya tathāgatāya / / namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
108 Buddhist stotras (bst-108u.htm.txt) 3686575 (0.040):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142835 (0.040):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405283 (0.040):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405307 (0.040):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405367 (0.040):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405405 (0.040):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995344 (0.042):
sakalabuddhadharmaparipūrṇāya svāhā / namo ratnatrayāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Hayagrivavidya (bsu017_u.htm.txt) 27758087 (0.046):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540775 (0.049):
dhū[pa-dī]pa-nivedana-mantraḥ / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405325 (0.053):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyā mahāsattvāyā /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540896 (0.054):
tatas- karmaṃ\var{karmaṃ\lem \cod BH; karma \Dutt} samārabhet / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540947 (0.055):
namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
tat- yathā ṭuru ṭuru ha ha ha ha\var{ha ha ha ha\lem \cod; hā hā hā hā
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540710 (0.0):
namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / / tat- yathā ha ha ha ha\var{ha ha ha ha\lem \cod; hā [hā hā] hā \Dutt} /
\Dutt} svāhā / / dhū[pa-dī]pa-nivedana-mantraḥ /
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540618 (0.0):
namas- vairocanāya tathāgatāya / / namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540703 (0.0):
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] // / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540749 (0.0):
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.} / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540811 (0.0):
gandha-puṣpa-<*>upanivedana-mantras- / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540837 (0.0):
bali-nivedana-mantras- eka-viṃśati-japena / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
108 Buddhist stotras (bst-108u.htm.txt) 3686577 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142836 (0.015):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405284 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405309 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405369 (0.015):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405407 (0.015):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Hayagrivavidya (bsu017_u.htm.txt) 27758088 (0.015):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995346 (0.019):
sakalabuddhadharmaparipūrṇāya svāhā / namo ratnatrayāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Ekadasamukham (bsu015_u.htm.txt) 21405246 (0.019):
namo ratnatrayāya / namo vairocanāya tathāgatāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namaḥ
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540950 (0.024):
namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
Ekadasamukham (bsu015_u.htm.txt) 21405430 (0.024):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahākāruṇikāya / tadyathā piṭi piṭi tiṭi tiṭi viṭi viṭi gaccha gaccha
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444350 (0.033):
atha khalu bhagavān āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Karandavyuha (bsu019_u.htm.txt) 7097546 (0.039):
śrīāryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya //
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540900 (0.040):
tatas- karmaṃ\var{karmaṃ\lem \cod BH; karma \Dutt} samārabhet / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukham (bsu015_u.htm.txt) 21405325 (0.053):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyā mahāsattvāyā /
tat- yathā siri siri dhiri dhiri siri dhiri\var{siri siri \lem \em based
on Chinese; thiri thiri \Dutt} svāhā /
Ekadasamukham (bsu015_u.htm.txt) 21405334 (0.064):
tadyathā thiri thiri dhiri dhiri svāhā / gandhapuṣpopanivedanamantraḥ /
gandha-puṣpa-<*>upanivedana-mantras- / / namas- ratna-trayāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540699 (0.016):
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] // / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540775 (0.021):
dhū[pa-dī]pa-nivedana-mantraḥ / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540833 (0.032):
bali-nivedana-mantras- eka-viṃśati-japena / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540897 (0.047):
tatas- karmaṃ\var{karmaṃ\lem \cod BH; karma \Dutt} samārabhet / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540747 (0.049):
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.} / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540945 (0.054):
namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
108 Buddhist stotras (bst-108u.htm.txt) 3686580 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995349 (0.0):
sakalabuddhadharmaparipūrṇāya svāhā / namo ratnatrayāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540619 (0.0):
namas- vairocanāya tathāgatāya / / namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540702 (0.0):
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] // / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540749 (0.0):
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.} / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540839 (0.0):
bali-nivedana-mantras- eka-viṃśati-japena / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540903 (0.0):
tatas- karmaṃ\var{karmaṃ\lem \cod BH; karma \Dutt} samārabhet / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540952 (0.0):
namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
Ekadasamukham (bsu015_u.htm.txt) 21405248 (0.0):
namo ratnatrayāya / namo vairocanāya tathāgatāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namaḥ
Ekadasamukham (bsu015_u.htm.txt) 21405371 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405409 (0.0):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405432 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Karandavyuha (bsu019_u.htm.txt) 7097548 (0.006):
śrīāryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya //
Ekadasamukham (bsu015_u.htm.txt) 21405349 (0.007):
namo ratnatrayāya / nama āryāvalokiteśvaraya bodhisattvāya mahāsattvāya / mahākāruṇikāya / tadyathā sāde sāde sidi sidi sudu sudu svāhā /
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444351 (0.008):
atha khalu bhagavān āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142837 (0.011):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405284 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405309 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Hayagrivavidya (bsu017_u.htm.txt) 27758089 (0.011):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540780 (0.024):
dhū[pa-dī]pa-nivedana-mantraḥ / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
tat- yathā sāde sāde / sidi sidi / sudu sudu svāhā /
Ekadasamukham (bsu015_u.htm.txt) 21405357 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvaraya bodhisattvāya mahāsattvāya / mahākāruṇikāya / tadyathā sāde sāde sidi sidi sudu sudu svāhā /
bali-nivedana-mantras- eka-viṃśati-japena /
Ekadasamukham (bsu015_u.htm.txt) 21405359 (0.027):
mahākāruṇikāya / tadyathā sāde sāde sidi sidi sudu sudu svāhā / / balinivedanamantra ekaviṃśatijāpena /
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
108 Buddhist stotras (bst-108u.htm.txt) 3686580 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995349 (0.0):
sakalabuddhadharmaparipūrṇāya svāhā / namo ratnatrayāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540620 (0.0):
namas- vairocanāya tathāgatāya / / namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540702 (0.0):
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] // / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540749 (0.0):
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.} / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540813 (0.0):
gandha-puṣpa-<*>upanivedana-mantras- / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540952 (0.0):
namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
Ekadasamukham (bsu015_u.htm.txt) 21405248 (0.0):
namo ratnatrayāya / namo vairocanāya tathāgatāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namaḥ
Ekadasamukham (bsu015_u.htm.txt) 21405371 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405409 (0.0):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405432 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Karandavyuha (bsu019_u.htm.txt) 7097548 (0.006):
śrīāryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya //
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444351 (0.008):
atha khalu bhagavān āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142837 (0.011):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405284 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405309 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Hayagrivavidya (bsu017_u.htm.txt) 27758089 (0.011):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540780 (0.024):
dhū[pa-dī]pa-nivedana-mantraḥ / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540903 (0.035):
namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya / / tat- yathā ili mili pili\var{pili\lem from Chinese; \omitted \Dutt} tili /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540896 (0.042):
tatas- karmaṃ\var{karmaṃ\lem \cod BH; karma \Dutt} samārabhet / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
tat- yathā masi\var{masi\lem \cod; yasi \Dutt}ddhasi cari huru icuruḥ
Ekadasamukham (bsu015_u.htm.txt) 21405378 (0.026):
mahākāruṇikāya / tadyathā yasi ddhasi cari huru icuruḥ suruḥ muruḥ svāhā /
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19042318 (0.047):
māle, khulu khulu vuru varuṇo, dhīre dharya, suru suru, hataṃ viṣaṃ,
suruḥ suru\var{suru\lem \cod; muruḥ \Dutt} svāhā /
homa-mantras- / / anena mantreṇa jātīkāṣṭhair\var{jātīkāṣṭhair\lem \cod; jñātinaṣṭais \Dutt}
agnim- prajvālya dadhi-madhu-ghṛta-abhyaktānām- ahorātra-uṣitena- ekena
Manjusrimulakalpa (bsu041_u.htm.txt) 11460483 (0.007):
pūjāṃ kṛtvā arkasamidbhiragniṃ prajvālya dadhimadhughṛtāktānāṃ
Manjusrimulakalpa (bsu041_u.htm.txt) 11462341 (0.007):
palāśakāṣṭhairagniṃ prajvālya, dadhimadhughṛtāktānāṃ gugguluguḍikānāṃ
Manjusrimulakalpa (bsu041_u.htm.txt) 11467501 (0.007):
gugguludhūpaṃ dahatā balāgniṃ prajvālya dadhimadhughṛtāktānāṃ
Manjusrimulakalpa (bsu041_u.htm.txt) 11470227 (0.007):
pūjāṃ kṛtvā homamārabhet / bilvasamidhānāmaṣṭaśatenāgniṃ prajvālya / dadhimadhughṛtāktānāṃ bilvasamidhānāmaṣṭasahasraṃ juhuyāt / yamicchati sa
Manjusrimulakalpa (bsu041_u.htm.txt) 11387066 (0.025):
udārāṃ pūjāṃ kṛtvā arkakāṣṭhairagniṃ prajvālya tilānāṃ / dadhimadhughṛtāktānāmaṣṭasahasraṃ juhuyāt / homānte āgacchati / dhanaṃ
Manjusrimulakalpa (bsu041_u.htm.txt) 11469698 (0.025):
aśvatthakāṣṭhairagniṃ prajvālya tilānāṃ dadhimadhughṛtāktānāṃ kṛtsnāṃ
Manjusrimulakalpa (bsu041_u.htm.txt) 11467165 (0.033):
bodhivṛkṣakāṣṭhairagniṃ prajvālya kumudānāṃ dadhimadhughṛtāktānāṃ
Ekadasamukham (bsu015_u.htm.txt) 21405390 (0.042):
homamantraḥ / anena mantreṇa jñātīnāṣṭai(?) ragniṃ prajvālya / dadhimadhudhṛtābhyaktānāmahorātrauṣikena ekena triṃśatā homaḥ kāryaḥ /
Manjusrimulakalpa (bsu041_u.htm.txt) 11470294 (0.059):
juhuyāt / suvarṇasahasraṃ labhati / udumbarakāṣṭhairagniṃ prajvālya / vāṣakasamidhānāṃ dadhimadhughṛtāktānāṃ śatasahasraṃ juhuyāt /
triṃśatā homa kāryaḥ / / tatas- karmaṃ\var{karmaṃ\lem \cod BH; karma \Dutt} samārabhet /
Ekadasamukham (bsu015_u.htm.txt) 21405397 (0.024):
dadhimadhudhṛtābhyaktānāmahorātrauṣikena ekena triṃśatā homaḥ kāryaḥ /
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
108 Buddhist stotras (bst-108u.htm.txt) 3686580 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995349 (0.0):
sakalabuddhadharmaparipūrṇāya svāhā / namo ratnatrayāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540620 (0.0):
namas- vairocanāya tathāgatāya / / namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540702 (0.0):
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] // / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540749 (0.0):
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.} / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540813 (0.0):
gandha-puṣpa-<*>upanivedana-mantras- / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540839 (0.0):
bali-nivedana-mantras- eka-viṃśati-japena / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540952 (0.0):
namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
Ekadasamukham (bsu015_u.htm.txt) 21405248 (0.0):
namo ratnatrayāya / namo vairocanāya tathāgatāya / nama / āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namaḥ
Ekadasamukham (bsu015_u.htm.txt) 21405370 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405411 (0.0):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405432 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Karandavyuha (bsu019_u.htm.txt) 7097548 (0.006):
śrīāryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya //
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444351 (0.008):
atha khalu bhagavān āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142837 (0.011):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405284 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405309 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Hayagrivavidya (bsu017_u.htm.txt) 27758089 (0.011):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540780 (0.024):
dhū[pa-dī]pa-nivedana-mantraḥ / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405325 (0.053):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyā mahāsattvāyā /
tat- yathā ili mili pili\var{pili\lem from Chinese; \omitted \Dutt} tili /
Ekadasamukham (bsu015_u.htm.txt) 21405413 (0.016):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahākāruṇikāya / tadyathā ili mili tili tili hili svāhā / dīpābaddha
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19042226 (0.048):
hili, mili mili mili mili, pili pili pili pili, kili kili, śīrṣeṇa varṣaṃ,
tili hili svāhā / / diśābandhas-\var{diśābandha\lem \em; dīpābaddha \Dutt} udakena sarṣapair
Mekhala-Dharani (mekhdh_u.htm.txt) 24324669 (0.059):
tili tili tili tili tili tili tili // ṣiṭi ṭape ṭaṭṛpe / olaṃbe mavisāre /
vā\var{sarṣapair vā\lem \em \Nagashima based on Chinese} bhasmanā vā
sapta-jāpena / / namas- ratna-trayāya / / [na]mas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya
108 Buddhist stotras (bst-108u.htm.txt) 3686580 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdayasutra (amoghapu.htm.txt) 16995349 (0.0):
āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namo
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540620 (0.0):
namas- vairocanāya tathāgatāya / / namas-āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-kāruṇikāya{ḥ} /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540813 (0.0):
gandha-puṣpa-<*>upanivedana-mantras- / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540839 (0.0):
namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahā-karuṇikāya /
Ekadasamukham (bsu015_u.htm.txt) 21405248 (0.0):
āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya / namaḥ
Ekadasamukham (bsu015_u.htm.txt) 21405370 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāyabodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405409 (0.0):
namo ratnatrayāya nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405434 (0.0):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Karandavyuha (bsu019_u.htm.txt) 7097548 (0.006):
śrīāryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahākāruṇikāya //
Svalpaksara prajnaparamita (bsu050_u.htm.txt) 24444351 (0.008):
atha khalu bhagavān āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Amoghapasahrdaya nama mahayanasutram (bsu002_u.htm.txt) 23142837 (0.011):
namo ratnatrayāya namo āryāvalokiteśvarāya bodhisattvāya mahāsattvāya
Ekadasamukham (bsu015_u.htm.txt) 21405284 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukham (bsu015_u.htm.txt) 21405309 (0.011):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāyamahāsattvāya /
Hayagrivavidya (bsu017_u.htm.txt) 27758089 (0.011):
sarvān vaḍavāmukhena nikṛntaya phaṭ / namo nama āryāvalokiteśvarāya / bodhisattvāya mahāsattvāya / sidhyantu mama maṃtrapadā hayagrīvo bhagavān
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540780 (0.024):
dhū[pa-dī]pa-nivedana-mantraḥ / / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540703 (0.026):
evam-\var{eṣa\lem evaṃ \Dutt} mūla-mantra[s-] // / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540903 (0.031):
namas- āryāvalokiteśvarāya bodhisattvāya mahāsattvāya mahā-karuṇikāya / / tat- yathā ili mili pili\var{pili\lem from Chinese; \omitted \Dutt} tili /
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540749 (0.055):
BHS for abhyukṣaṇa- or confused with \dhatu{kṣip-}.} / namas- ratna-trayāya / / namas- āryāvalokiteśvarāya bodhisattvā[ya ma]hāsattvāya /
tat- yathā piṭi piṭi tiṭi tiṭi / viṭi\var{viṭi viṭi\lem \cod; siṭi siṭi
Ekadasamukham (bsu015_u.htm.txt) 21405438 (0.004):
namo ratnatrayāya / nama āryāvalokiteśvarāya bodhisattvāya mahāsattvāya / mahākāruṇikāya / tadyathā piṭi piṭi tiṭi tiṭi viṭi viṭi gaccha gaccha
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540686 (0.033):
mili ciṭi\var{ciṭi\lem \cod; viṭi \Dutt} svāhā /
Pratisarakalpadharani (psarkdhu.htm.txt) 27874667 (0.053):
mānini mahāmānini mānadhāriṇi cale vicale vimale viṭi viṭi taṭi tiṭi niṭi / niṭi tuṭṭe dhoriṇi dhariṇi nimiṇi viriṇi vīryaṇi pracale pravarasamare
viṭi viṭi Chinese} viṭi gaccha gaccha bhagavan-\var{bhagavan\lem \em
Ekadasamukham (bsu015_u.htm.txt) 21405441 (0.026):
mahākāruṇikāya / tadyathā piṭi piṭi tiṭi tiṭi viṭi viṭi gaccha gaccha
(illegible in photo); bhagavān \Dutt} āryāvalokiteśvara sva-bhavanam-
Ekadasamukham (bsu015_u.htm.txt) 21405448 (5.960):
bhagavānāryāvalokiteśvara svabhavanaṃ svabhavanaṃ svāhā / udake saptavārān
Ekadasamukhahrdayam (ekmuhr_u.htm.txt) 18540590 (0.023):
tatra\var{tatra\lem \cod; tataḥ \Dutt} khalu- āryāvalokiteśvaras-
sva-bhavanam- svāhā / / udake sapta-vārā parijapya caturdiśam- kṣipe\com{kṣipe\lem \cod; kṣipet
Ekadasamukham (bsu015_u.htm.txt) 21405454 (0.0):
bhagavānāryāvalokiteśvara svabhavanaṃ svabhavanaṃ svāhā / udake saptavārān
\Dutt; the MSS's reading should mean that the sādhaka speaks these words
Mrgendragama (=Mrgendratantra) (mrgt3cpu.htm.txt) 971690 (0.024):
%% \Bhatt's reading would indeed give what seems a strange gloss here,
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557132 (0.029):
Another feature which exceeds what might be expected from a
Mrgendragama (=Mrgendratantra) (mrgt3cpu.htm.txt) 971742 (0.031):
%% to enclose the praṇava just mentioned in verse 31 and that the / %% teacher would use it while explaining maṇḍalas.
Bhamaha: Kavyalamkara (bhakavpu.htm.txt) 4072784 (0.031):
%% Bhāmaha might be intending to convey that he is not dogmatic on the / point by suggesting that Rāmaśarman might have intended the imbalance.
Jiva Gosvamin: Radhakrsnarcanadipika (jivrkadu.htm.txt) 18433258 (0.032):
[*NOTE: This appears to be evidence that 8 is the original source of the
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556942 (0.032):
identical with the stem which would be entered in a dictionary.
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23556882 (0.032):
Devan-agar-i) to indicate that fact that a printed (and
ASVAGHOSA: BUDDHACARITA (asvbc_1u.htm.txt) 1033301 (0.033):
Long interpolations may be entered as a sequence of separate
Buddhasvamin: Brhatkathaslokasamgraha (brkas_pu.htm.txt) 5743811 (0.033):
to share it with everyone, who will find it useful. However you / should know that there are certain deviations from Lac%
Sanghabhedavastu (vinv172u.htm.txt) 18001190 (0.033):
Devadatta perceives that the workmen and the mechanic too ran away, and
Gheranda-Samhita (ghers_au.htm.txt) 10187624 (0.034):
The principle of transliteration" has been that the input format should"
Kiranatantra, chapters 1-6 (kirtc_pu.htm.txt) 10704986 (0.039):
quoted ad /Nar/ 2:8, p.130 and frequently in the /MatV.} / ityevaṃ sādhakabādhakapramāṇābhāvasadbhāvābhyāmīśvarābhāvasiddhiriti
Mrgendragama (=Mrgendra-Tantra) (mrgt14pu.htm.txt) 3604709 (0.041):
%% This last half-line appears as part of the commentary (Ked p.104, lines
Mrgendragama (=Mrgendratantra) (mrgt3cpu.htm.txt) 977819 (0.047):
%% The text is evidently incomplete; all the MSS used by \Bhatt\ and
Nagaropamasutra (nagsu_tu.htm.txt) 15616567 (0.047):
which is the only extant MS that preserves, almost entirely, that part of
Mrgendragama (=Mrgendratantra) (mrgt3cpu.htm.txt) 976893 (0.048):
%% group and construes with pāda c; pāda d means then `the one [mantra] / %% that is in the centre of the brahmamantras [viz. aghora]'.
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557788 (0.051):
a way that it agrees with the textual reference. In the
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557550 (0.052):
Long interpolations may be entered as a sequence of separate
Manusmrti (manu1__u.htm.txt) 21507835 (0.052):
[M.prāṇāntako][ṃ's com refers to the reading of prāṇāntika ".]"
Gheranda-Samhita (ghers_au.htm.txt) 10187239 (0.052):
The text transliterated is based on a file which represents the text as
as part of the mantra} / / āryāvalokiteśvara gaccha sva-bhavanaṃḥ //
Mrgendragama (=Mrgendra-Tantra) (mrgt14pu.htm.txt) 3604709 (0.015):
%% This last half-line appears as part of the commentary (Ked p.104, lines
Kuḍaka's Samanvayadiś (SD) (samanv_u.htm.txt) 13215658 (0.019):
of these texts and the (apparently popular grammar) verses cited in works
Nagaropamasutra (nagsu_tu.htm.txt) 15616567 (0.020):
which is the only extant MS that preserves, almost entirely, that part of
Mrgendragama (=Mrgendratantra) (mrgt3cpu.htm.txt) 977881 (0.021):
%% as Brunner observes (1985:412, n.2), is part of the conclusion to the
ASVAGHOSA: BUDDHACARITA (asvbc_2u.htm.txt) 23557173 (0.024):
buddha+carita). In case of sandhi, the + functions also as / sa.mdhi--marker, i..e. no additional sandhi--marker is added
Mrgendragama (=Mrgendratantra) (mrgt3cpu.htm.txt) 975331 (0.025):
%% liṅgas given as an appendix that Bhatt holds to be from a later part of / %% the \CP. [Brunner says the same in her note 1985:393, n.3]
Jiva Gosvamin: Radhakrsnarcanadipika (jivrkadu.htm.txt) 18432689 (0.025):
[*NOTE: This is the starting point of the Bhagavat-sandarbha. The two
A Digital edition of the Abhisamacarika-Dharma (abhisdhu.htm.txt) 14493044 (0.026):
supplied after them. This applies to the omission of the virAma.
Naradasmrti (narads_u.htm.txt) 13218163 (0.027):
included in ñolly's edition and translation is not to be part of the / original ṇāradasmṛti
Naradasmrti (nars2_pu.htm.txt) 3613951 (0.027):
is not to be part of the original Nāradasmṛti (see the Introduction to the
Gheranda-Samhita (ghers_au.htm.txt) 10187239 (0.027):
The text transliterated is based on a file which represents the text as
Sanghabhedavastu (vinv172u.htm.txt) 18006614 (0.030):
The elephant Dhanapālaka follows submissively the Buddha, dies of grief / and is reborn in the heaven of the four great kings
Varahamihira: Brhatsamhita (brhats_u.htm.txt) 10202203 (0.032):
Varitants for the part beginning with * are supplied in [ ] .
Vaikhaanasa Dharmasuutra \VKHDHS)1-3 (vaikhd_u.htm.txt) 28546803 (0.037):
dakṣiṇapāda.aṅguṣṭhāgreṇa-aśmānam\adhitiṣṭhet) tejo.vatsava iti\on the / reading of the mantra, cf. Cal p.122n.4) valkalam ajinaṃ cīraṃvā paridhāya
Ekadasamukham (bsu015_u.htm.txt) 21405444 (0.039):
mahākāruṇikāya / tadyathā piṭi piṭi tiṭi tiṭi viṭi viṭi gaccha gaccha / bhagavānāryāvalokiteśvara svabhavanaṃ svabhavanaṃ svāhā / udake saptavārān
Mahendravarman I: Mattavilasaprahasana (mmatvipu.htm.txt) 13950454 (0.043):
(14) Unni prints (part of) the commentary in G: grāmasūkaraḥ kukkuraḥ,
Nagaropamasutra (nagsu_pu.htm.txt) 27451360 (0.047):
which is the only extant MS that preserves, almost entirely, that part of / the appendix not found in the Pelliot/Stein MS. Because our reconstruction
end of hayagrīvāvidyā folio a different hand adds:
oṃ namo ratnatrāyāyaḥ namaś caṇḍavajrapāṇa{ā}ye mahāśaktasenāpaye . tad
Garuda-Purana (garup1_u.htm.txt) 6797855 (0.045):
oṃ namo (bhagavateḥ vāsudevāca namaḥ sarvāpahāriṇe /
Brahma-Purana, Adhyayas 1 - 246 (brahmpau.htm.txt) 26783371 (0.047):
namo vāsanivāsāya % vāsavyavaharāya ca // BrP_59.61 // / oṃ namo vasukartre ca $ vasuvāsapradāya ca &
Brahma-Purana, Adhyayas 1 - 246 (brahmppu.htm.txt) 11054686 (0.047):
namo vāsanivāsāya vāsavyavaharāya ca // BrP_59.61 // / oṃ namo vasukartre ca vasuvāsapradāya ca /
Agni-Purana (agp_bi_u.htm.txt) 4887636 (0.048):
kheca hṛdayāya namaḥ / khecaryai namaḥ / oṃ caṇḍāyai namaḥ / chedanyai
Agni-Purana (agp_bi_u.htm.txt) 4782178 (0.048):
vighnarājo gṛhadvāre peṣaṇyāṃ subhage namaḥ //AP_77.016cd/ / oṃ raudrike namo girike(2) namaś caolūkhale yajet /AP_77.017ab/
Garuda-Purana (garup1_u.htm.txt) 6705096 (0.048):
oṃ ādhāraśaktayai namaḥ / / oṃ kūrṃmāya namaḥ / / oṃ anantāya namaḥ /
Garuda-Purana (garup1_u.htm.txt) 6698295 (0.048):
oṃ satyāyai namaḥ / / oṃ īśānāyai namaḥ / / oṃ sarvatomukhyai namaḥ /
Garuda-Purana (garup1_u.htm.txt) 6698286 (0.048):
oṃ kriyāyai namaḥ / / oṃ yogāyai namaḥ / / oṃ prahvyai namaḥ /
Garuda-Purana (garup1_u.htm.txt) 6705161 (0.048):
oṃ satyāyai namaḥ / / oṃ īśānāyai namaḥ / / oṃ anugrahāyai namaḥ // GarP_1,30.6 //
Garuda-Purana (garup1_u.htm.txt) 6705778 (0.048):
oṃ satyāyai namaḥ / / oṃ īśānāyai namaḥ / / oṃ anugrahāyai namaḥ // GarP_1,31.15 //
Agni-Purana (agp_bi_u.htm.txt) 4799748 (0.051):
/ aṃ anaiśvaryāya namaḥ / huṃ vāce huṃ ca rāgiṇyai kraiṃ jvālinyai tato / namaḥ / oṃ hrauṃ śamāyai(5) ca namaḥ / hruṃ jyeṣṭhāyai tato namaḥ / oṃ
Anandabhatta: Vallalacarita (anvallcu.htm.txt) 19566335 (0.052):
namo yāmyāya kṣemyāya ślokyāya ca namonamaḥ / / urvaryyāyāvasānyāya khalyāya ca namastu te // Valc_2,20.44 //
Anandabhatta: Vallalacarita (anvallcu.htm.txt) 19566481 (0.052):
namo vrajyāya goṣṭhāya talpāya ca namonamaḥ // Valc_2,20.57 //
Anandabhatta: Vallalacarita (anvallcu.htm.txt) 19566512 (0.052):
parṇaśadāya parṇāya namaścābhighnate namaḥ / / nama udguramāṇāya namaḥ ākhidate namaḥ // Valc_2,20.60 //
Anandabhatta: Vallalacarita (anvallcu.htm.txt) 19566196 (0.052):
aśvebhyo 'śvapatibhyaścāvyādhinībhyo namonamaḥ / / vividhyantībhyaśca namaḥ ugaṇābhyo namonamaḥ // Valc_2,20.32 //
Anandabhatta: Vallalacarita (anvallcu.htm.txt) 19566172 (0.052):
āyacchadbhyo namo 'syadbhyo visṛjadbhyo namo namaḥ / / vidhyadbhyaśca svapadbhyaśca jāgradbhyaśca namonamaḥ // Valc_2,20.30 //
Anandabhatta: Vallalacarita (anvallcu.htm.txt) 19566346 (0.052):
namo vandyāya kakṣyāya śravāya ca namonamaḥ / / pratiśravāya ca namaḥ āśuṣeṇāya te namaḥ // Valc_2,20.45 //
Anandabhatta: Vallalacarita (anvallcu.htm.txt) 19566415 (0.052):
avarṣyāya ca varṣāya vātyāya ca namonamaḥ / / namo brātyāya reṣmāya vāstavyāya namonamaḥ // Valc_2,20.51 //
Sivamahimnastava (sivmstau.htm.txt) 9510379 (0.052):
namo nediṣṭhāya priyadava daviṣṭhāya ca namo / namaḥ kṣodiṣṭhāya smarahara mahiṣṭhāya ca namaḥ |
Mahamayurividyarajni (Mmvr) (mmayuvru.htm.txt) 19039907 (0.052):
maitreyapramukhānāṃ bodhisatvānāṃ mahāsatvānāṃ, namo 'nāgāmināṃ, namaḥ / sakṛdāgāmināṃ, namaḥ śrotāpannānāṃ, namo loke samyaggatānāṃ, namaḥ